Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin-4 peptide derivative

Product Specifications

Bioactivity

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

Molecular Formula

NA

Molecular Weight

3692.15

Shipping Conditions

Ice Packs

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Nostoc punctiforme ATP synthase gamma chain (atpG)
MBS1259749-01 0.02 mg (E-Coli)

Recombinant Nostoc punctiforme ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Nostoc punctiforme ATP synthase gamma chain (atpG)
MBS1259749-02 0.02 mg (Yeast)

Recombinant Nostoc punctiforme ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Nostoc punctiforme ATP synthase gamma chain (atpG)
MBS1259749-03 0.1 mg (E-Coli)

Recombinant Nostoc punctiforme ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Nostoc punctiforme ATP synthase gamma chain (atpG)
MBS1259749-04 0.1 mg (Yeast)

Recombinant Nostoc punctiforme ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Nostoc punctiforme ATP synthase gamma chain (atpG)
MBS1259749-05 0.02 mg (Baculovirus)

Recombinant Nostoc punctiforme ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Nostoc punctiforme ATP synthase gamma chain (atpG)
MBS1259749-06 0.02 mg (Mammalian-Cell)

Recombinant Nostoc punctiforme ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details