Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Fibroblast growth factor 23 (FGF23) (R174Q)

Product Specifications

CAS Number

9000-83-3

Gene Name

FGF23

UniProt

A0A337SEX6

Expression Region

1-245aa (R174Q)

Organism

Felis catus (Cat) (Felis silvestris catus)

Target Sequence

MSGTRLGLLVSVLCWVVRAYPNTSPLLGSSWGGLTHLYTATARNSYHLQIHKDGHVDGTPHQTIYSALMIRSEDAGFVVITGVMSQRYLCMDFRGNIFGSHLFSPESCRFRQRTLENGYDVYHSPQHRFLVSLGPAKRAFLPGTNPPPYSQFLSRRNEIPLVHFNTPRPRRHTRSAEDAERDPLNVLKPRPRMTPAPASCSQELPSAEDSGVVASDPLGVLRGNRVNAHAGGMGVERCRPFPKFN

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Field of Research

Cancer

Assay Type

Developed Protein

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-100 1x 100 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-500 1x 500 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-500 1x 500 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF488A conjugate, 0.1mg/mL
BNC882558-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF488A conjugate, 0.1mg/mL
BNC881884-100 1x 100 µL

Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details