Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat STEAP family member 1 (Steap1)

Product Specifications

Abbreviation

Recombinant Rat Steap1 protein

Gene Name

Steap1

UniProt

D3ZEK7

Expression Region

1-339aa

Organism

Rattus norvegicus (Rat)

Target Sequence

MEISKNITNPEELWKMKPKGNLEDDSYSTKDTGETSMLKRPVLSPLPHTVHVDAFDCPTELQHTQELFPNWQLPIKVAAVLSSLTFLYTLLREIIYPLVASREQYFYKIPILVVNKVLPMVSITLLALVYLPGEIAAVVQLRNGTKYKKFPPWLDRWMLARKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYKQVQQSKEDAWVEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTVHASIFAWNKWVDISQFVWYMPPTFMIAVFLPTVVLICKIVLCLPCLRKKILKIRCGWEDVRKVNRTEMACRL

Tag

C-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF488A conjugate, 0.1mg/mL
BNC880152-100 1x 100 µL

CD11c (HC1/1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF568 conjugate, 0.1mg/mL
BNC680176-100 1x 100 µL

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF647 conjugate, 0.1mg/mL
BNC470322-100 1x 100 µL

CD3e (RIV9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
BNC880460-500 1x 500 µL

CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
BNC940304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details