Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD81 Antibody

CD81 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. This protein is a cell surface glycoprotein, known to complex with integrins and appears to promote muscle cell fusion and support myotube maintenance, acting as platform for receptor clustering and signalling motility

Product Specifications

Product Name Alternative

CD81 antigen, CVID6, S5.7, TAPA1, Tetraspanin-28, TSPAN28 antibody

Reactivity

Canine, Human, Monkey, Mouse, Rat

Immunogen

Antigen: Purified recombinant peptide derived from within residues 115 aa to 205 aa of human CD81 produced in E. coli. Antigen Sequence: NKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIG

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Immunology & Inflammation

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:1,000-1:2,000

Form

Polyclonal antibody supplied as a 100 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human Histone H3 (Phospho Ser10) Polyclonal Antibody
PA85347HU-01 50 µg

Rabbit Anti-Human Histone H3 (Phospho Ser10) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Histone H3 (Phospho Ser10) Polyclonal Antibody
PA85347HU-02 100 µg

Rabbit Anti-Human Histone H3 (Phospho Ser10) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Histone H3 (Phospho Ser10) Polyclonal Antibody
PA85347HU-03 500 µg

Rabbit Anti-Human Histone H3 (Phospho Ser10) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Histone H3 (Phospho Ser10) Polyclonal Antibody
PA85347HU-04 1 mg

Rabbit Anti-Human Histone H3 (Phospho Ser10) Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Methylococcus capsulatus Lipid A export ATP-binding/permease protein MsbA (msbA)
orb2913587-01 20 µg

Recombinant Methylococcus capsulatus Lipid A export ATP-binding/permease protein MsbA (msbA)

Sign In for Pricing
View Details
Recombinant Methylococcus capsulatus Lipid A export ATP-binding/permease protein MsbA (msbA)
orb2913587-02 100 µg

Recombinant Methylococcus capsulatus Lipid A export ATP-binding/permease protein MsbA (msbA)

Sign In for Pricing
View Details