Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-3 (IL3) (Active)

Product Specifications

Product Name Alternative

Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3

Abbreviation

Recombinant Human IL-3 protein (Active)

Gene Name

IL-3

UniProt

P08700

Expression Region

20-152aa

Organism

Homo sapiens (Human)

Target Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Tag

Tag free

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.02-0.1 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGA2FB N-Glycan
297608 20 µg

NGA2FB N-Glycan

Sign In for Pricing
View Details
LILRA3/CD85e/ILT6, Human (Biotinylated, HEK293, His-Avi)
HY-P72393 1 Each

LILRA3/CD85e/ILT6, Human (Biotinylated, HEK293, His-Avi)

Sign In for Pricing
View Details
PPFIA2 Rabbit Polyclonal Antibody (HRP)
orb2082446 100 µL

PPFIA2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ZAK (sterile alpha Motif and Leucine zipper Containing Kinase AZK, AZK, MLK7, MLT, MLTK, MRK, mlklak) (Biotin)
253528-Biotin 100 µL

ZAK (sterile alpha Motif and Leucine zipper Containing Kinase AZK, AZK, MLK7, MLT, MLTK, MRK, mlklak) (Biotin)

Sign In for Pricing
View Details
IFluor® 460 succinimidyl ester
71022-AAT 100 µg

IFluor® 460 succinimidyl ester

Sign In for Pricing
View Details
TGFA Antibody
KC-3635-01 50 μL

TGFA Antibody

Sign In for Pricing
View Details