Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein Wiz (WIZ), partial

Product Specifications

Product Name Alternative

Widely-interspaced zinc finger-containing protein; Zinc finger protein 803

Abbreviation

Recombinant Human WIZ protein, partial

Gene Name

WIZ

UniProt

O95785

Expression Region

1228-1419aa

Organism

Homo sapiens (Human)

Target Sequence

MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFRTRCEFCGEFFENRKGLSSHARSHLRQMGVTEWSVNGSPIDTLREILKKKSKPCLIKKEPPAGDLAPALAEDGPPTVAPGPVQSPLPLSPLAGRPGKPGAGPAQVPRELSLTPITGAKPSATGYLGSVAAKRPLQEDRLLPAEVKAKTYIQTELPFKAKTLHEKTSHSSTEACCELCGLYFENRKALASHARAH

Tag

C-terminal 6xHis-Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

May link EHMT1 and EHMT2 histone methyltransferases to the CTBP corepressor machinery. May be involved in EHMT1-EHMT2 heterodimer formation and stabilization (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.1 kDa

References & Citations

"CDYL bridges REST and histone methyltransferases for gene repression and suppression of cellular transformation." Mulligan P., Westbrook T.F., Ottinger M., Pavlova N., Chang B., Macia E., Shi Y.J., Barretina J., Liu J., Howley P.M., Elledge S.J., Shi Y. Mol. Cell 32:718-726 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-INSM2 Antibody Picoband®, APC Conjugate
A14973-1-APC 100 µg/Vial

Anti-INSM2 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Recombinant Human RAE1L (His)
BP4082-50ug 50 µg

Recombinant Human RAE1L (His)

Sign In for Pricing
View Details
Anti-FASTKD2 antibody
STJ118938 100 µl

Anti-FASTKD2 antibody

Sign In for Pricing
View Details
MMP8, ID (Matrix Metalloproteinase 8) (APC)
MBS6486997-01 0.2 mL

MMP8, ID (Matrix Metalloproteinase 8) (APC)

Sign In for Pricing
View Details
MMP8, ID (Matrix Metalloproteinase 8) (APC)
MBS6486997-02 5x 0.2 mL

MMP8, ID (Matrix Metalloproteinase 8) (APC)

Sign In for Pricing
View Details
CHDH CRISPR Activation Plasmid (h2)
sc-409285-ACT-2 20 µg

CHDH CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details