Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) (Active)

Product Specifications

Product Name Alternative

(Non-specific crossreacting antigen) (Normal cross-reacting antigen) (CD66c)

Abbreviation

Recombinant Human CEACAM6 protein (Active)

Gene Name

CEACAM6

UniProt

P40199

Expression Region

35-320aa

Organism

Homo sapiens (Human)

Target Sequence

KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Tags & Cell Markers

Relevance

Cell surface glycoprotein that plays a role in cell adhesion and tumor progression. Intercellular adhesion occurs in a calcium- and fibronectin-independent manner. Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM5 and CEACAM8) . Heterophilic interaction with CEACAM8 occurs in activated neutrophils. Plays a role in neutrophil adhesion to cytokine-activated endothelial cells . Plays a role as an oncogene by promoting tumor progression; positively regulates cell migration, cell adhesion to endothelial cells and cell invasion. Also involved in the metastatic cascade process by inducing gain resistance to anoikis of pancreatic adenocarcinoma and colorectal carcinoma cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

①Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Human CEACAM8 (CSB-MP005168HU), the EC50 is 144.7-223.8 ng/mL.②Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Anti- CEACAM5/CEACAM6 recombinant antibody (CSB-RA005165MA2HU), the EC50 is 0.9430-1.377 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.6 kDa

References & Citations

"Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography." Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J. Proteomics 8:1346-1361 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EnzyFluo™ Isocitrate Assay Kit
EFIC-100 100 Tests

EnzyFluo™ Isocitrate Assay Kit

Sign In for Pricing
View Details
ELOVL7 (NM_001104558) Human Over-expression Lysate
LC426203 20 µg

ELOVL7 (NM_001104558) Human Over-expression Lysate

Sign In for Pricing
View Details
Human AGBL4 activation kit by CRISPRa
GA113728 1 Kit

Human AGBL4 activation kit by CRISPRa

Sign In for Pricing
View Details
Strn Mouse Gene Knockout Kit (CRISPR)
KN516914 1 Kit

Strn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TGFBR1 Antibody
KC-44415-01 50 μL

TGFBR1 Antibody

Sign In for Pricing
View Details
TGFBR1 Antibody
KC-44415-02 100 µL

TGFBR1 Antibody

Sign In for Pricing
View Details