Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lymphotactin/XCL1, Human

XCL1, a C class chemokine also known as Lymphotactin, is mainly produced by activated CD8+ T cells and natural killer cells. XCL1 signals by binding to the XCR1 receptor. XCL1 is involved in infectious, inflammatory and immunological diseases[1]. Lymphotactin/XCL1 Protein, Human (HEK293, Fc-His) is produced in E. coli, and consists of 92 amino acids (G23-G114) .

Product Specifications

Product Name Alternative

Lymphotactin/XCL1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lymphotactin-xcl1-protein-human.html

Purity

98.0

Smiles

GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Molecular Formula

6375 (Gene_ID) P47992 (G23-G114) (Accession)

Molecular Weight

Approximately 10.2-15 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Lei Y, et al. XCL1 and XCR1 in the immune system. Microbes Infect. 2012 Mar;14 (3) :262-7.|[2]Lei Y, et al. XCL1 and XCR1 in the immune system. Microbes Infect. 2012 Mar;14 (3) :262-7.|[3]Yuan Tian, et al. Blockade of XCL1/Lymphotactin Ameliorates Severity of Periprosthetic Osteolysis Triggered by Polyethylene-Particles. Front Immunol. 2020 Aug 4;11:1720.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-500 1x 500 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
BNC040745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details