Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lymphotactin/XCL1, Human

XCL1, a C class chemokine also known as Lymphotactin, is mainly produced by activated CD8+ T cells and natural killer cells. XCL1 signals by binding to the XCR1 receptor. XCL1 is involved in infectious, inflammatory and immunological diseases[1]. Lymphotactin/XCL1 Protein, Human (HEK293, Fc-His) is produced in E. coli, and consists of 92 amino acids (G23-G114) .

Product Specifications

Product Name Alternative

Lymphotactin/XCL1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lymphotactin-xcl1-protein-human.html

Purity

98.0

Smiles

GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Molecular Formula

6375 (Gene_ID) P47992 (G23-G114) (Accession)

Molecular Weight

Approximately 10.2-15 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Lei Y, et al. XCL1 and XCR1 in the immune system. Microbes Infect. 2012 Mar;14 (3) :262-7.|[2]Lei Y, et al. XCL1 and XCR1 in the immune system. Microbes Infect. 2012 Mar;14 (3) :262-7.|[3]Yuan Tian, et al. Blockade of XCL1/Lymphotactin Ameliorates Severity of Periprosthetic Osteolysis Triggered by Polyethylene-Particles. Front Immunol. 2020 Aug 4;11:1720.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GM-CSF R alpha Antibody (4H1) [FITC]
NBP1-43361F 0.1 mL

Mouse Monoclonal GM-CSF R alpha Antibody (4H1) [FITC]

Sign In for Pricing
View Details
MDFI Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
28260065 1.0 µg DNA

MDFI Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
UCP4 Double Nickase Plasmid (m)
sc-428681-NIC 20 µg

UCP4 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
NNT-set siRNA/shRNA/RNAi Lentivector (Human)
31968091 4x 500 ng

NNT-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
GLUD1 (Lengsin, Glutamate Dehydrogenase 1)
481903 100 µL

GLUD1 (Lengsin, Glutamate Dehydrogenase 1)

Sign In for Pricing
View Details
NDUFB8 Conjugated Antibody
orb1611183 100 µL

NDUFB8 Conjugated Antibody

Sign In for Pricing
View Details