Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free BMP-6, Human (His)

BMP-6 protein is a member of the TGF-β superfamily and is critical in various developmental processes including skeletal development. It acts as a key regulator of HAMP/hepcidin expression and iron metabolism via hemojuvelin/HJV. Animal-Free BMP-6 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free BMP-6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-bmp-6-protein-human-his.html

Purity

98.0

Smiles

MVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH

Molecular Formula

654 (Gene_ID) P22004 (V397-H513) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-NARFL Antibody, Affinity Purified
MBS3905871-01 0.01 mg

Rabbit anti-NARFL Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-NARFL Antibody, Affinity Purified
MBS3905871-02 0.1 mg

Rabbit anti-NARFL Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-NARFL Antibody, Affinity Purified
MBS3905871-03 5x 0.01 mg

Rabbit anti-NARFL Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-NARFL Antibody, Affinity Purified
MBS3905871-04 5x 0.1 mg

Rabbit anti-NARFL Antibody, Affinity Purified

Sign In for Pricing
View Details
PRPF38A Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
37759064 1.0 µg DNA

PRPF38A Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Ins2 Protein Vector (Rat) (pPB-N-His)
PV274799 500 ng

Ins2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details