Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2AX (H2AFX), partial

Product Specifications

Product Name Alternative

Histone H2A.X

Abbreviation

Recombinant Human H2AFX protein, partial

Gene Name

H2AFX

UniProt

P16104

Expression Region

12-141aa

Organism

Homo sapiens (Human)

Target Sequence

RAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQ

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Required for checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for efficient repair of DNA double strand breaks (DSBs) specifically when modified by C-terminal phosphorylation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Required for checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for efficient repair of DNA double strand breaks (DSBs) specifically when modified by C-terminal phosphorylation.

Molecular Weight

17.8 kDa

References & Citations

"H2A.X. a histone isoprotein with a conserved C-terminal sequence, is encoded by a novel mRNA with both DNA replication type and polyA 3' processing signals." Mannironi C., Bonner W.M., Hatch C.L. Nucleic Acids Res. 17:9113-9126 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAB4 Antibody
8C12388-AAT 50 µg

GAB4 Antibody

Sign In for Pricing
View Details
Zc2hc1b Mouse Gene Knockout Kit (CRISPR)
KN519632 1 Kit

Zc2hc1b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ACTG2 Rabbit Polyclonal Antibody
TA361463 100 µL

ACTG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CF®488A, Aminooxy
#92051 1x 1 mg

CF®488A, Aminooxy

Sign In for Pricing
View Details
DNA Ligase I (LIG1) (N-term) Rabbit Polyclonal Antibody
AP52477PU-N 400 µL

DNA Ligase I (LIG1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Bromo-L-phenylalanine
TRC-B678923-250MG 250 mg

4-Bromo-L-phenylalanine

Sign In for Pricing
View Details