Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterovirus A71 Genome polyprotein, partial

Product Specifications

Product Name Alternative

VP4-VP2 (P1A) (Virion protein 4) (Capsid protein VP2) (P1B) (Virion protein 2) (P1C) (Virion protein 3) (P1D) (Virion protein 1) (Picornain 2A) (Protein 2A) (Protein 3B) (P3B) (3D polymerase) (3Dpol) (Protein 3D)

Abbreviation

Recombinant Enterovirus A71 Genome polyprotein, partial

UniProt

F6KTB0

Expression Region

1441-1497aa

Organism

Enterovirus A71

Target Sequence

GPPKFKPIKISLEEKPAPDAISDLLASVDSEEVRQYCRDQGWIIPETPTNVERHLNR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Capsid protein VP0: Component of immature procapsids, which is cleaved into capsid proteins VP4 and VP2 after maturation. Allows the capsid to remain inactive before the maturation step.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

7.4 kDa

References & Citations

"Enterovirus 71 and coxsackievirus A16 3C proteases: binding to rupintrivir and their substrates and anti-hand, foot, and mouth disease virus drug design." Lu G., Qi J., Chen Z., Xu X., Gao F., Lin D., Qian W., Liu H., Jiang H., Yan J., Gao G.F. J. Virol. 85:10319-10331 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGN sgRNA CRISPR Lentivector (Human) (Target 3)
K1815504 1.0 µg DNA

RGN sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
C2orf83 CRISPR Activation Plasmid (h2)
sc-412729-ACT-2 20 µg

C2orf83 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
LOC100364794 3'UTR GFP Stable Cell Line
TU259257 1.0 mL

LOC100364794 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Syn Antibody
orb3159862-01 50 µL

Syn Antibody

Sign In for Pricing
View Details
Syn Antibody
orb3159862-02 100 µL

Syn Antibody

Sign In for Pricing
View Details
Mal-NH-PEG2-NH-Mal
MD022022-2 Inquire

Mal-NH-PEG2-NH-Mal

Sign In for Pricing
View Details