Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free EGF, Mouse (His)

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. Animal-Free EGF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free EGF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-egf-protein-mouse-his.html

Purity

98.00

Smiles

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGK2 (NM_016276) Human Over-expression Lysate
LY414080 100 µg

SGK2 (NM_016276) Human Over-expression Lysate

Sign In for Pricing
View Details
Gonadotropin Releasing Hormone Receptor (GNRHR) Porcine ELISA Kit
D8028 96 Tests

Gonadotropin Releasing Hormone Receptor (GNRHR) Porcine ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-GCC2 antibody
SL13311R-01 50 µL

Rabbit Anti-GCC2 antibody

Sign In for Pricing
View Details
Rabbit Anti-GCC2 antibody
SL13311R-02 100 µL

Rabbit Anti-GCC2 antibody

Sign In for Pricing
View Details
Phospho-IRS1 (Tyr632) Polyclonal Antibody, PE-Cy5 Conjugated
bs-8707R-PE-Cy5 100 µL

Phospho-IRS1 (Tyr632) Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
HT920 (Van 32686) Hybridoma
T9081 1x106 cells / 1.0 mL

HT920 (Van 32686) Hybridoma

Sign In for Pricing
View Details