Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free EGF, Mouse (His)

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. Animal-Free EGF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free EGF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-egf-protein-mouse-his.html

Purity

98.00

Smiles

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Receptor-interacting serine/threonine-protein kinase 3 (RIPK3) ELISA Kit
YLA1498RA-01 48 Tests

Rat Receptor-interacting serine/threonine-protein kinase 3 (RIPK3) ELISA Kit

Sign In for Pricing
View Details
Rat Receptor-interacting serine/threonine-protein kinase 3 (RIPK3) ELISA Kit
YLA1498RA-02 96 Tests

Rat Receptor-interacting serine/threonine-protein kinase 3 (RIPK3) ELISA Kit

Sign In for Pricing
View Details
ITCH Antibody
MBS7121003-01 0.05 mg

ITCH Antibody

Sign In for Pricing
View Details
ITCH Antibody
MBS7121003-02 0.1 mg

ITCH Antibody

Sign In for Pricing
View Details
ITCH Antibody
MBS7121003-03 5x 0.1 mg

ITCH Antibody

Sign In for Pricing
View Details
Human EHMT2 Recombinant Protein
PPT-12461 100 µg

Human EHMT2 Recombinant Protein

Sign In for Pricing
View Details