Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free EGF, Mouse (His)

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. Animal-Free EGF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free EGF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-egf-protein-mouse-his.html

Purity

98.00

Smiles

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc93 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7354105 3x 1.0 µg

Ccdc93 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PHF23 siRNA (h)
sc-93976 10 µM

PHF23 siRNA (h)

Sign In for Pricing
View Details
UNC93A sgRNA CRISPR Lentivector (Human) (Target 1)
K2589502 1.0 µg DNA

UNC93A sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CuLlin 4B (CuL4B) (NM_003588) Human Tagged Lenti ORF Clone
RC206935L2 10 µg

CuLlin 4B (CuL4B) (NM_003588) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal Seasonal H1N1 Nucleocapsid Protein Antibody [Alexa Fluor 700]
NBP2-41114AF700 0.1 mL

Rabbit Polyclonal Seasonal H1N1 Nucleocapsid Protein Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Lrrc32 3'UTR GFP Stable Cell Line
TU262568 1.0 mL

Lrrc32 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details