Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free EGF, Mouse (His)

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. Animal-Free EGF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free EGF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-egf-protein-mouse-his.html

Purity

98.00

Smiles

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYBB Polyclonal Antibody
E-AB-70273-01 60 μL

CYBB Polyclonal Antibody

Sign In for Pricing
View Details
CYBB Polyclonal Antibody
E-AB-70273-02 120 μL

CYBB Polyclonal Antibody

Sign In for Pricing
View Details
CYBB Polyclonal Antibody
E-AB-70273-03 200 µL

CYBB Polyclonal Antibody

Sign In for Pricing
View Details
Cyclomarin monomer-2
HY-P11498 1 Each

Cyclomarin monomer-2

Sign In for Pricing
View Details
3-Bromo-5-formylbenzonitrile
TRC-B683770-1G 1 g

3-Bromo-5-formylbenzonitrile

Sign In for Pricing
View Details
Mouse Olfr1494 (NM_146990) AAV Particle
MR214532A1V 250 µL

Mouse Olfr1494 (NM_146990) AAV Particle

Sign In for Pricing
View Details