Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free EGF, Mouse (His)

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. Animal-Free EGF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free EGF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-egf-protein-mouse-his.html

Purity

98.00

Smiles

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Selplg sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6134405 3x 1.0 µg

Selplg sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Human IL-1 RII (NP_004624) VersaClone cDNA
RDC1142 10 µg

Human IL-1 RII (NP_004624) VersaClone cDNA

Sign In for Pricing
View Details
ABplex Human 13-Plex Custom Panel
RK04342-01 48 Tests

ABplex Human 13-Plex Custom Panel

Sign In for Pricing
View Details
ABplex Human 13-Plex Custom Panel
RK04342-02 96 Tests

ABplex Human 13-Plex Custom Panel

Sign In for Pricing
View Details
Laminin α-1 (h) -PR
sc-37125-PR 10 µM - 20 µL

Laminin α-1 (h) -PR

Sign In for Pricing
View Details
Active Vascular Endothelial Growth Factor Receptor 2 (VEGFR2)
SBPB226Hu01-01 10 µg

Active Vascular Endothelial Growth Factor Receptor 2 (VEGFR2)

Sign In for Pricing
View Details