Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free EGF, Mouse (His)

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. Animal-Free EGF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free EGF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-egf-protein-mouse-his.html

Purity

98.00

Smiles

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FNIP1 Antibody
NBP2-49647-25ul 25 µL

Rabbit Polyclonal FNIP1 Antibody

Sign In for Pricing
View Details
IgA Saliva ELISA (RUO)
SA E-6800R 96 Determinations

IgA Saliva ELISA (RUO)

Sign In for Pricing
View Details
CD5 (CD5 Molecule, LEU1, T1) (Biotin)
244404-Biotin 100 µL

CD5 (CD5 Molecule, LEU1, T1) (Biotin)

Sign In for Pricing
View Details
Saccharocarcin A
MF-0152513 2500 µg

Saccharocarcin A

Sign In for Pricing
View Details
Recombinant Human PRH1 Protein
NBP2-23368 0.05 mg

Recombinant Human PRH1 Protein

Sign In for Pricing
View Details
TM4SF4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2381305 3x 1.0 µg

TM4SF4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details