Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free EGF, Mouse (His)

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. Animal-Free EGF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free EGF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-egf-protein-mouse-his.html

Purity

98.00

Smiles

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSCB 3'UTR Luciferase Stable Cell Line
TU010186 1.0 mL

HSCB 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DMTF1 (DMP1, Cyclin-D-binding Myb-like Transcription Factor 1, Cyclin-D-interacting Myb-like Protein 1, hDMTF1) (APC)
125913-APC 100 µL

DMTF1 (DMP1, Cyclin-D-binding Myb-like Transcription Factor 1, Cyclin-D-interacting Myb-like Protein 1, hDMTF1) (APC)

Sign In for Pricing
View Details
ELISpot Plus: Mouse IL-2 (ALP)
3441-4APW-2 2 Plates

ELISpot Plus: Mouse IL-2 (ALP)

Sign In for Pricing
View Details
Anti-h D-Dimer 1401 SPTN-5
MBS5680408-01 1 mg

Anti-h D-Dimer 1401 SPTN-5

Sign In for Pricing
View Details
Anti-h D-Dimer 1401 SPTN-5
MBS5680408-02 5x 1 mg

Anti-h D-Dimer 1401 SPTN-5

Sign In for Pricing
View Details
Styphnolobium japonicum Lectin (SJA) - Pure
21510877-1 5mg

Styphnolobium japonicum Lectin (SJA) - Pure

Sign In for Pricing
View Details