Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free EGF, Mouse (His)

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. Animal-Free EGF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free EGF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-egf-protein-mouse-his.html

Purity

98.00

Smiles

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP1LC3B
525124-01 100 µL

MAP1LC3B

Sign In for Pricing
View Details
MAP1LC3B
525124-02 200 µL

MAP1LC3B

Sign In for Pricing
View Details
Human Apolipoprotein E4 (Apo E4) AssayLite™ Antibody (RPE Conjugate)
22212-05051 5x 30 µg

Human Apolipoprotein E4 (Apo E4) AssayLite™ Antibody (RPE Conjugate)

Sign In for Pricing
View Details
MRPL36 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV685733 1.0 µg DNA

MRPL36 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Human Cytochrome B5 Reductase 1 (CYB5R1) ELISA Kit
abx386755 96 Tests

Human Cytochrome B5 Reductase 1 (CYB5R1) ELISA Kit

Sign In for Pricing
View Details
NMDAR2B Antibody
ASA-B1389 1 Each

NMDAR2B Antibody

Sign In for Pricing
View Details