Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free EGF, Mouse (His)

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. Animal-Free EGF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free EGF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-egf-protein-mouse-his.html

Purity

98.00

Smiles

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collectin-11 (COLEC11) Mouse ELISA Kit
C5319 96 Tests

Collectin-11 (COLEC11) Mouse ELISA Kit

Sign In for Pricing
View Details
B3GALT5 (NM_006057) Human Over-expression Lysate
LC416890 20 µg

B3GALT5 (NM_006057) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) HIM1 Polyclonal Antibody
MBS7182303 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) HIM1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal TRAPPC6B Antibody
NBP2-13478-25ul 25 µL

Rabbit Polyclonal TRAPPC6B Antibody

Sign In for Pricing
View Details
GLUT2 (Glucose Transporter Type 2, Solute Carrier Family 2, Facilitated Glucose Transporter Member 2, SLC2A2) (PE)
052133 100 µg

GLUT2 (Glucose Transporter Type 2, Solute Carrier Family 2, Facilitated Glucose Transporter Member 2, SLC2A2) (PE)

Sign In for Pricing
View Details
Mouse Tmcc3 Pre-designed siRNA Set B
SI114710B 1 Each

Mouse Tmcc3 Pre-designed siRNA Set B

Sign In for Pricing
View Details