Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free EGF, Mouse (His)

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. Animal-Free EGF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free EGF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-egf-protein-mouse-his.html

Purity

98.00

Smiles

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse G-CSF MAb (Clone 67604R)
MAB414R-100 100 µg

Mouse G-CSF MAb (Clone 67604R)

Sign In for Pricing
View Details
Arhgef2 ORF Vector (Mouse) (pORF)
ORF038993 1.0 µg DNA

Arhgef2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Ccd1/DIXDC1 Recombinant Protein Antigen
NBP2-58141PEP 100 µL

Ccd1/DIXDC1 Recombinant Protein Antigen

Sign In for Pricing
View Details
PTH2R Antibody, HRP conjugated
A32412-50UG 50 µg

PTH2R Antibody, HRP conjugated

Sign In for Pricing
View Details
HSPBP1 Mouse Monoclonal Antibody [Clone ID: LBI3E1]
AMM11765V 100 µL

HSPBP1 Mouse Monoclonal Antibody [Clone ID: LBI3E1]

Sign In for Pricing
View Details
Genesig Real-Time PCR Detection Kit for Merkel Cell Polyomavirus, Standard
349320 1 Kit

Genesig Real-Time PCR Detection Kit for Merkel Cell Polyomavirus, Standard

Sign In for Pricing
View Details