Nogo Receptor/NgR, Mouse (HEK293, His)
Nogo receptor/NgR proteins act as receptors for RTN4, OMG, MAG, and sialylated gangliosides. It also binds chondroitin sulfate proteoglycans and heparin. Nogo Receptor/NgR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Nogo Receptor/NgR protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
Nogo Receptor/NgR Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/nogo-receptor-ngr-protein-mouse-hek-293-his.html
Purity
97.00
Smiles
CPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEGCAVASGPFRPIQTSQLTDEELLSLPKCCQPDAADKASVLEPGRPASAGNALKGRVPPGDTPPGNGSGPRHINDSPFGTLPSSAEPPLTALRPGGSEPPGLPTTGPRRRPGCSRKNRTRSHCRLGQAGSGASGTGDAEGS
Molecular Formula
65079 (Gene_ID) Q99PI8 (C27-S447) (Accession)
Molecular Weight
75-85 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880460-500 1x 500 µL
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470030-500 1x 500 µL
Insulin (2D11-H5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940012-500 1x 500 µL
Tyrosinase (T311), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041203-100 1x 100 µL
Smooth Muscle Actin (ACTA2/791 +1A4), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details