Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nogo Receptor/NgR, Mouse (HEK293, His)

Nogo receptor/NgR proteins act as receptors for RTN4, OMG, MAG, and sialylated gangliosides. It also binds chondroitin sulfate proteoglycans and heparin. Nogo Receptor/NgR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Nogo Receptor/NgR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Nogo Receptor/NgR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nogo-receptor-ngr-protein-mouse-hek-293-his.html

Purity

97.00

Smiles

CPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEGCAVASGPFRPIQTSQLTDEELLSLPKCCQPDAADKASVLEPGRPASAGNALKGRVPPGDTPPGNGSGPRHINDSPFGTLPSSAEPPLTALRPGGSEPPGLPTTGPRRRPGCSRKNRTRSHCRLGQAGSGASGTGDAEGS

Molecular Formula

65079 (Gene_ID) Q99PI8 (C27-S447) (Accession)

Molecular Weight

75-85 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBLD Recombinant Protein Antigen
NBP1-83683PEP 0.1 mL

PBLD Recombinant Protein Antigen

Sign In for Pricing
View Details
Importin 9 (IPO9) Human shRNA Plasmid Kit (Locus ID 55705)
TL303901 1 Kit

Importin 9 (IPO9) Human shRNA Plasmid Kit (Locus ID 55705)

Sign In for Pricing
View Details
pBV220-NDH2-mCherry Plasmid
PVT58593 2 µg

pBV220-NDH2-mCherry Plasmid

Sign In for Pricing
View Details
GDPD3 Protein Lysate (Human) with C-Ha Tag
21432031 100 µg

GDPD3 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
S100A12 Rabbit Polyclonal Antibody (PerCP)
orb2488585 100 µL

S100A12 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Anti-SMARCB1 Polyclonal Antibody
TMAB-12958-01 50 μL

Anti-SMARCB1 Polyclonal Antibody

Sign In for Pricing
View Details