Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDF-1 alpha/CXCL12, Mouse

SDF-1 alpha (Stromal Cell-Derived Factor-1α, SDF-1α) is a member of the chemokine α subfamily that lack the ELR domain. SDF-1α works as a chemoattractant for T- and B-lymphocytes and monocytes. SDF-1α is a ligand for CXCR4. The SDF-1α/CXCR4 signaling mediates many physiological processes including cell trafficking, angiogenesis, embryogenesis, tumor invasion and metastatic. It also controls the chemotaxis of hematopoietic stem cells homing to the bone marrow[1][2]. SDF-1 alpha/CXCL12 Protein, Mouse is produced in E. coli.

Product Specifications

Product Name Alternative

SDF-1 alpha/CXCL12 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sdf-1-alpha-cxcl12-protein-mouse.html

Purity

98.0

Smiles

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Molecular Formula

20315 (Gene_ID) P40224-1 (K22-K89) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Kryczek I, et al. Stroma-derived factor (SDF-1/CXCL12) and human tumor pathogenesis. Am J Physiol Cell Physiol. 2007 Mar;292 (3) :C987-95.|[2]Santhosh K Ghadge, et al. SDF-1α as a therapeutic stem cell homing factor in myocardial infarction. Pharmacol Ther. 2011 Jan;129 (1) :97-108.|[3]Zheng Jiang, et al. Contribution of SDF-1α/CXCR4 signaling to brain development and glioma progression. Neurosignals. 2013;21 (3-4) :240-58.|[4]Zhiqiang Meng, et al. SDF Factor-1α Promotes the Migration, Proliferation, and Osteogenic Differentiation of Mouse Bone Marrow Mesenchymal Stem Cells Through the Wnt/β-Catenin Pathway. Stem Cells Dev. 2021 Jan 15;30 (2) :106-117.|[5]Yonghui Dong, et al. Inhibition of SDF-1α/CXCR4 Signalling in Subchondral Bone Attenuates Post-Traumatic Osteoarthritis. Int J Mol Sci. 2016 Jun 16;17 (6) :943.|[6]Ge Zhang, et al. Controlled release of stromal cell-derived factor-1 alpha in situ increases c-kit+ cell homing to the infarcted heart. Tissue Eng. 2007 Aug;13 (8) :2063-71.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL17RA Protein (His Tag)
PDMH100167-01 20 µg

Recombinant Human IL17RA Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL17RA Protein (His Tag)
PDMH100167-02 100 µg

Recombinant Human IL17RA Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL17RA Protein (His Tag)
PDMH100167-03 500 µg

Recombinant Human IL17RA Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL17RA Protein (His Tag)
PDMH100167-04 1 mg

Recombinant Human IL17RA Protein (His Tag)

Sign In for Pricing
View Details
LAP3 Recombinant Rabbit monoclonal Antibody
HA750704 100 µL

LAP3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Ear2 (NM_007895) Mouse Tagged ORF Clone
MG201169 10 µg

Ear2 (NM_007895) Mouse Tagged ORF Clone

Sign In for Pricing
View Details