Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-9, Human (HEK293, hFc)

Activin AB protein is a member of the transforming growth factor-β (TGF-β) superfamily and plays a key role in various biological processes such as cell differentiation, proliferation, and apoptosis. It is involved in embryonic development, tissue repair and immune regulation. FGF-9 Protein, Human (HEK293, hFc) is the recombinant human-derived FGF-9 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

FGF-9 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-9-protein-human-hek293-n-hfc.html

Purity

96.00

Smiles

LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

2254 (Gene_ID) NP_002001.1 (L4-S208) (Accession)

Molecular Weight

Approximately 55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse G2e3 shRNA (UAS) - Lentiviral mouse G2e3 shRNA (UAS, iRFP) (100)
GTR15291807 1 Vial

Lentiviral mouse G2e3 shRNA (UAS) - Lentiviral mouse G2e3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Monoclonal STAT3 Antibody (monoclonal) (M02), Clone: 4D6
APR11203G 0.1mg

Monoclonal STAT3 Antibody (monoclonal) (M02), Clone: 4D6

Sign In for Pricing
View Details
GCNT2 Antibody; Biotin conjugated
MBS7004292-01 0.05 mg

GCNT2 Antibody; Biotin conjugated

Sign In for Pricing
View Details
GCNT2 Antibody; Biotin conjugated
MBS7004292-02 0.1 mg

GCNT2 Antibody; Biotin conjugated

Sign In for Pricing
View Details
GCNT2 Antibody; Biotin conjugated
MBS7004292-03 5x 0.1 mg

GCNT2 Antibody; Biotin conjugated

Sign In for Pricing
View Details
ARHGAP25 Antibody
61-689 400 µL

ARHGAP25 Antibody

Sign In for Pricing
View Details