Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP1B1, Mouse (Cell-Free, His)

The ATP1B1 protein is a noncatalytic component that forms a heterodimer with the α subunit and catalyzes ATP hydrolysis and Na (+) and K (+) ion exchange across the plasma membrane. These heterodimers critically regulate sodium pumping at the plasma membrane, affecting ion balance. ATP1B1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived ATP1B1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

ATP1B1 Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp1b1-protein-mouse-cf-his.html

Purity

90.00

Smiles

MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS

Molecular Formula

11931 (Gene_ID) P14094 (M1-S304) (Accession)

Molecular Weight

Monomer: 35 kDa Dimer: 70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)
MBS1026194-01 0.02 mg (E-Coli)

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

Sign In for Pricing
View Details
Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)
MBS1026194-02 0.1 mg (E-Coli)

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

Sign In for Pricing
View Details
Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)
MBS1026194-03 1 mg (E-Coli)

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

Sign In for Pricing
View Details
Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)
MBS1026194-04 5x 1 mg (E-Coli)

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

Sign In for Pricing
View Details
Vinblastine sulfate
S4505-1g 1 g

Vinblastine sulfate

Sign In for Pricing
View Details
GRIN2A Antibody
orb2684847-01 50 µL

GRIN2A Antibody

Sign In for Pricing
View Details