Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Human (His-Trx)

The CHRNA1 Protein undergoes a substantial conformational shift upon acetylcholine binding, influencing all subunits and leading to the activation of an ion-conducting channel. Yet, the acetylcholine receptor alpha subunit of CHRNA1 can be non-functional in certain cases, underscoring the need to comprehend the factors governing its functionality and integration into fully operational acetylcholine-gated cation-selective channels. CHRNA1 Protein, Human (His-Trx) is the recombinant human-derived CHRNA1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Human (His-Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-human-his-trx.html

Purity

90.0

Smiles

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Molecular Formula

1134 (Gene_ID) P02708 (S21-L255) (Accession)

Molecular Weight

Approximately 44.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prl5a1 (NM_023746) Mouse Tagged Lenti ORF Clone
MR202761L3 10 µg

Prl5a1 (NM_023746) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat macrophage inflammatory protein 1α (MIP-1α) ELISA Kit
GA-E0377RT-01 48 Tests

Rat macrophage inflammatory protein 1α (MIP-1α) ELISA Kit

Sign In for Pricing
View Details
Rat macrophage inflammatory protein 1α (MIP-1α) ELISA Kit
GA-E0377RT-02 96 Tests

Rat macrophage inflammatory protein 1α (MIP-1α) ELISA Kit

Sign In for Pricing
View Details
HDDC3 (Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1, HD Domain-containing Protein 3, Metazoan SpoT Homolog 1, MESH1, Penta-phosphate Guanosine-3'-pyrophosphohydrolase, (ppGpp)ase, MESH1, MGC45386)
MBS6003810-01 0.1 mg

HDDC3 (Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1, HD Domain-containing Protein 3, Metazoan SpoT Homolog 1, MESH1, Penta-phosphate Guanosine-3'-pyrophosphohydrolase, (ppGpp)ase, MESH1, MGC45386)

Sign In for Pricing
View Details
HDDC3 (Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1, HD Domain-containing Protein 3, Metazoan SpoT Homolog 1, MESH1, Penta-phosphate Guanosine-3'-pyrophosphohydrolase, (ppGpp)ase, MESH1, MGC45386)
MBS6003810-02 5x 0.1 mg

HDDC3 (Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1, HD Domain-containing Protein 3, Metazoan SpoT Homolog 1, MESH1, Penta-phosphate Guanosine-3'-pyrophosphohydrolase, (ppGpp)ase, MESH1, MGC45386)

Sign In for Pricing
View Details
GENLISA™ Mouse Protein Interacting With C Kinase 1 (PICK1) ELISA
KLM6112 1x 96 Well

GENLISA™ Mouse Protein Interacting With C Kinase 1 (PICK1) ELISA

Sign In for Pricing
View Details