Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Human (His-Trx)

The CHRNA1 Protein undergoes a substantial conformational shift upon acetylcholine binding, influencing all subunits and leading to the activation of an ion-conducting channel. Yet, the acetylcholine receptor alpha subunit of CHRNA1 can be non-functional in certain cases, underscoring the need to comprehend the factors governing its functionality and integration into fully operational acetylcholine-gated cation-selective channels. CHRNA1 Protein, Human (His-Trx) is the recombinant human-derived CHRNA1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Human (His-Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-human-his-trx.html

Purity

90.0

Smiles

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Molecular Formula

1134 (Gene_ID) P02708 (S21-L255) (Accession)

Molecular Weight

Approximately 44.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken SST ELISA Kit
ECKS0199 96 Tests

Chicken SST ELISA Kit

Sign In for Pricing
View Details
Recombinant Human P4HB, N-GST
MBS1573082-01 0.1 mg

Recombinant Human P4HB, N-GST

Sign In for Pricing
View Details
Recombinant Human P4HB, N-GST
MBS1573082-02 1 mg

Recombinant Human P4HB, N-GST

Sign In for Pricing
View Details
Recombinant Human P4HB, N-GST
MBS1573082-03 5x 1 mg

Recombinant Human P4HB, N-GST

Sign In for Pricing
View Details
Human Ankyrin repeat domain-containing protein 9 (ANKRD9) ELISA Kit
abx501771 96 Tests

Human Ankyrin repeat domain-containing protein 9 (ANKRD9) ELISA Kit

Sign In for Pricing
View Details
PDE4B3 Antibody FITC-Conjugated
MBS543505-01 0.1 mg

PDE4B3 Antibody FITC-Conjugated

Sign In for Pricing
View Details