Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Human (His-Trx)

The CHRNA1 Protein undergoes a substantial conformational shift upon acetylcholine binding, influencing all subunits and leading to the activation of an ion-conducting channel. Yet, the acetylcholine receptor alpha subunit of CHRNA1 can be non-functional in certain cases, underscoring the need to comprehend the factors governing its functionality and integration into fully operational acetylcholine-gated cation-selective channels. CHRNA1 Protein, Human (His-Trx) is the recombinant human-derived CHRNA1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Human (His-Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-human-his-trx.html

Purity

90.0

Smiles

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Molecular Formula

1134 (Gene_ID) P02708 (S21-L255) (Accession)

Molecular Weight

Approximately 44.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRB2 (NM_002086) Human Recombinant Protein
TP720535L 500 µg

GRB2 (NM_002086) Human Recombinant Protein

Sign In for Pricing
View Details
ATX1 (Ataxin 1) (MaxLight 650) [KO Validated]
A4159-04G-ML650 100 µL

ATX1 (Ataxin 1) (MaxLight 650) [KO Validated]

Sign In for Pricing
View Details
PDZD11 (NM_016484) Human Tagged ORF Clone Lentiviral Particle
RC201049L4V 200 µL

PDZD11 (NM_016484) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2093353-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2093353-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2093353-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details