Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Human (His-Trx)

The CHRNA1 Protein undergoes a substantial conformational shift upon acetylcholine binding, influencing all subunits and leading to the activation of an ion-conducting channel. Yet, the acetylcholine receptor alpha subunit of CHRNA1 can be non-functional in certain cases, underscoring the need to comprehend the factors governing its functionality and integration into fully operational acetylcholine-gated cation-selective channels. CHRNA1 Protein, Human (His-Trx) is the recombinant human-derived CHRNA1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Human (His-Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-human-his-trx.html

Purity

90.0

Smiles

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Molecular Formula

1134 (Gene_ID) P02708 (S21-L255) (Accession)

Molecular Weight

Approximately 44.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti Rabbit IgG (H+L)
41R-1075 2 mg

Goat anti Rabbit IgG (H+L)

Sign In for Pricing
View Details
ZNF131, ID (ZNF131, Zinc finger protein 131) (Biotin) discontinued
044126-Biotin 200 µL

ZNF131, ID (ZNF131, Zinc finger protein 131) (Biotin) discontinued

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Adenylosuccinate synthetase (purA)
MBS1236387-01 0.02 mg (E-Coli)

Recombinant Burkholderia pseudomallei Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Adenylosuccinate synthetase (purA)
MBS1236387-02 0.02 mg (Yeast)

Recombinant Burkholderia pseudomallei Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Adenylosuccinate synthetase (purA)
MBS1236387-03 0.1 mg (E-Coli)

Recombinant Burkholderia pseudomallei Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Adenylosuccinate synthetase (purA)
MBS1236387-04 0.1 mg (Yeast)

Recombinant Burkholderia pseudomallei Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details