Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Human (His-Trx)

The CHRNA1 Protein undergoes a substantial conformational shift upon acetylcholine binding, influencing all subunits and leading to the activation of an ion-conducting channel. Yet, the acetylcholine receptor alpha subunit of CHRNA1 can be non-functional in certain cases, underscoring the need to comprehend the factors governing its functionality and integration into fully operational acetylcholine-gated cation-selective channels. CHRNA1 Protein, Human (His-Trx) is the recombinant human-derived CHRNA1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Human (His-Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-human-his-trx.html

Purity

90.0

Smiles

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Molecular Formula

1134 (Gene_ID) P02708 (S21-L255) (Accession)

Molecular Weight

Approximately 44.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAGLN2 (NM_003564) Human Recombinant Protein
TP303473L 1 mg

TAGLN2 (NM_003564) Human Recombinant Protein

Sign In for Pricing
View Details
Human H1-7 Pre-designed siRNA Set B
SI006792B 1 Each

Human H1-7 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SRD5A2L2, CT (TECRL, SRD5A2L2, Trans-2,3-enoyl-CoA reductase-like, Steroid 5-alpha-reductase 2-like 2 protein) (APC) discontinued
042296-APC 200 µL

SRD5A2L2, CT (TECRL, SRD5A2L2, Trans-2,3-enoyl-CoA reductase-like, Steroid 5-alpha-reductase 2-like 2 protein) (APC) discontinued

Sign In for Pricing
View Details
BRK1 Protein Vector (Human) (pPB-His-MBP)
PV327554 500 ng

BRK1 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
APC Anti-Mouse IL-6 Antibody
JOT22201F 20Tests

APC Anti-Mouse IL-6 Antibody

Sign In for Pricing
View Details
L-Selectin/CD62L Antibody
3632-30T 30 µg

L-Selectin/CD62L Antibody

Sign In for Pricing
View Details