Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Human (His-Trx)

The CHRNA1 Protein undergoes a substantial conformational shift upon acetylcholine binding, influencing all subunits and leading to the activation of an ion-conducting channel. Yet, the acetylcholine receptor alpha subunit of CHRNA1 can be non-functional in certain cases, underscoring the need to comprehend the factors governing its functionality and integration into fully operational acetylcholine-gated cation-selective channels. CHRNA1 Protein, Human (His-Trx) is the recombinant human-derived CHRNA1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Human (His-Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-human-his-trx.html

Purity

90.0

Smiles

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Molecular Formula

1134 (Gene_ID) P02708 (S21-L255) (Accession)

Molecular Weight

Approximately 44.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Host cell factor C2 (HCFC2) (NM_013320) Human Over-expression Lysate
LY415672 100 µg

Host cell factor C2 (HCFC2) (NM_013320) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal ATAD4 Antibody
NBP1-90075-25ul 25 µL

Rabbit Polyclonal ATAD4 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Mrgprd shRNA (UAS) - Lentiviral mouse Mrgprd shRNA (UAS) plasmid
GTR15234655 1 Vial

Lentiviral mouse Mrgprd shRNA (UAS) - Lentiviral mouse Mrgprd shRNA (UAS) plasmid

Sign In for Pricing
View Details
EMD rabbit pAb
UB-GEN-8576 100 µL

EMD rabbit pAb

Sign In for Pricing
View Details
Escherichia coli O157:H7 protein Polyclonal Antibody, PerCP Conjugated
bs-44031R-PerCP 100 µL

Escherichia coli O157:H7 protein Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
P-p90 S6K alpha 1 (S380) Antibody, mAb, Rabbit
A02952-100 100 µL

P-p90 S6K alpha 1 (S380) Antibody, mAb, Rabbit

Sign In for Pricing
View Details