Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Human (His-Trx)

The CHRNA1 Protein undergoes a substantial conformational shift upon acetylcholine binding, influencing all subunits and leading to the activation of an ion-conducting channel. Yet, the acetylcholine receptor alpha subunit of CHRNA1 can be non-functional in certain cases, underscoring the need to comprehend the factors governing its functionality and integration into fully operational acetylcholine-gated cation-selective channels. CHRNA1 Protein, Human (His-Trx) is the recombinant human-derived CHRNA1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Human (His-Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-human-his-trx.html

Purity

90.0

Smiles

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Molecular Formula

1134 (Gene_ID) P02708 (S21-L255) (Accession)

Molecular Weight

Approximately 44.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat DTNB shRNA Plasmid
abx990429-01 150 µg

Rat DTNB shRNA Plasmid

Sign In for Pricing
View Details
Rat DTNB shRNA Plasmid
abx990429-02 300 µg

Rat DTNB shRNA Plasmid

Sign In for Pricing
View Details
anti-DUSP11
YF-PA15640 50 ug

anti-DUSP11

Sign In for Pricing
View Details
Streptavidin - 80nm Gold NanoUrchins, Lyophilized
GUAC-80-04-LY 1 mL

Streptavidin - 80nm Gold NanoUrchins, Lyophilized

Sign In for Pricing
View Details
Mouse UV excision repair protein RAD23 homolog A (RAD23A) ELISA Kit
abx541751 96 Tests

Mouse UV excision repair protein RAD23 homolog A (RAD23A) ELISA Kit

Sign In for Pricing
View Details
RPL37P24 3'UTR GFP Stable Cell Line
TU071570 1.0 mL

RPL37P24 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details