Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Human (His-Trx)

The CHRNA1 Protein undergoes a substantial conformational shift upon acetylcholine binding, influencing all subunits and leading to the activation of an ion-conducting channel. Yet, the acetylcholine receptor alpha subunit of CHRNA1 can be non-functional in certain cases, underscoring the need to comprehend the factors governing its functionality and integration into fully operational acetylcholine-gated cation-selective channels. CHRNA1 Protein, Human (His-Trx) is the recombinant human-derived CHRNA1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Human (His-Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-human-his-trx.html

Purity

90.0

Smiles

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Molecular Formula

1134 (Gene_ID) P02708 (S21-L255) (Accession)

Molecular Weight

Approximately 44.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP1LC3A (NM_181509) Human Tagged Lenti ORF Clone
RC220473L2 10 µg

MAP1LC3A (NM_181509) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
EXOC6B (NM_015189) Human Tagged Lenti ORF Clone
RC224563L4 10 µg

EXOC6B (NM_015189) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-Human CBS Polyclonal Antibody
PHE11901 100 μg

Anti-Human CBS Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-AOAH Polyclonal Antibody
PAV417 100 μL

Rabbit Anti-AOAH Polyclonal Antibody

Sign In for Pricing
View Details
omniPETTE - Rotating Stand
CV-RS 1 Unit

omniPETTE - Rotating Stand

Sign In for Pricing
View Details
RGD1563325 AAV Vector (Rat) (CMV)
39325106 1 µg

RGD1563325 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details