Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Human (His-Trx)

The CHRNA1 Protein undergoes a substantial conformational shift upon acetylcholine binding, influencing all subunits and leading to the activation of an ion-conducting channel. Yet, the acetylcholine receptor alpha subunit of CHRNA1 can be non-functional in certain cases, underscoring the need to comprehend the factors governing its functionality and integration into fully operational acetylcholine-gated cation-selective channels. CHRNA1 Protein, Human (His-Trx) is the recombinant human-derived CHRNA1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Human (His-Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-human-his-trx.html

Purity

90.0

Smiles

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Molecular Formula

1134 (Gene_ID) P02708 (S21-L255) (Accession)

Molecular Weight

Approximately 44.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Cytokeratin 18 (Ser51) Antibody
MBS9612917-01 0.1 mL

Phospho-Cytokeratin 18 (Ser51) Antibody

Sign In for Pricing
View Details
Phospho-Cytokeratin 18 (Ser51) Antibody
MBS9612917-02 0.2 mL

Phospho-Cytokeratin 18 (Ser51) Antibody

Sign In for Pricing
View Details
Phospho-Cytokeratin 18 (Ser51) Antibody
MBS9612917-03 5x 0.2 mL

Phospho-Cytokeratin 18 (Ser51) Antibody

Sign In for Pricing
View Details
6-Chloro-2,3-dihydro-1H-pyrrolo[3,2-c]pyridine
TRC-C277800-1G 1 g

6-Chloro-2,3-dihydro-1H-pyrrolo[3,2-c]pyridine

Sign In for Pricing
View Details
Ccdc87 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6163802 1.0 µg DNA

Ccdc87 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Mouse mmu-miR-466d-5p miRNA Agomir
abx883122-01 5 nmol

Mouse mmu-miR-466d-5p miRNA Agomir

Sign In for Pricing
View Details