Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Human (His-Trx)

The CHRNA1 Protein undergoes a substantial conformational shift upon acetylcholine binding, influencing all subunits and leading to the activation of an ion-conducting channel. Yet, the acetylcholine receptor alpha subunit of CHRNA1 can be non-functional in certain cases, underscoring the need to comprehend the factors governing its functionality and integration into fully operational acetylcholine-gated cation-selective channels. CHRNA1 Protein, Human (His-Trx) is the recombinant human-derived CHRNA1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Human (His-Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-human-his-trx.html

Purity

90.0

Smiles

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Molecular Formula

1134 (Gene_ID) P02708 (S21-L255) (Accession)

Molecular Weight

Approximately 44.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Beta-Endorphin, β-EP GENLISA ELISA
KLM0672 96 Well

Mouse Beta-Endorphin, β-EP GENLISA ELISA

Sign In for Pricing
View Details
Porcine Hemojuvelin HJV ELISA Kit
BG-POR11227 1 Each

Porcine Hemojuvelin HJV ELISA Kit

Sign In for Pricing
View Details
PKC iota, NT (Protein Kinase C iota Type, Atypical Protein Kinase C-lambda/iota, PRKC-lambda/iota, aPKC-lambda/iota, nPKC-iota, PRKCI, DXS1179E) (PE)
MBS6495245-01 0.2 mL

PKC iota, NT (Protein Kinase C iota Type, Atypical Protein Kinase C-lambda/iota, PRKC-lambda/iota, aPKC-lambda/iota, nPKC-iota, PRKCI, DXS1179E) (PE)

Sign In for Pricing
View Details
PKC iota, NT (Protein Kinase C iota Type, Atypical Protein Kinase C-lambda/iota, PRKC-lambda/iota, aPKC-lambda/iota, nPKC-iota, PRKCI, DXS1179E) (PE)
MBS6495245-02 5x 0.2 mL

PKC iota, NT (Protein Kinase C iota Type, Atypical Protein Kinase C-lambda/iota, PRKC-lambda/iota, aPKC-lambda/iota, nPKC-iota, PRKCI, DXS1179E) (PE)

Sign In for Pricing
View Details
Human SSRP1 Recombinant Protein
PPT-15473 100 µg

Human SSRP1 Recombinant Protein

Sign In for Pricing
View Details
Tematropium
MBS3614748-01 2 mg

Tematropium

Sign In for Pricing
View Details