Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Human (His-Trx)

The CHRNA1 Protein undergoes a substantial conformational shift upon acetylcholine binding, influencing all subunits and leading to the activation of an ion-conducting channel. Yet, the acetylcholine receptor alpha subunit of CHRNA1 can be non-functional in certain cases, underscoring the need to comprehend the factors governing its functionality and integration into fully operational acetylcholine-gated cation-selective channels. CHRNA1 Protein, Human (His-Trx) is the recombinant human-derived CHRNA1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Human (His-Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-human-his-trx.html

Purity

90.0

Smiles

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Molecular Formula

1134 (Gene_ID) P02708 (S21-L255) (Accession)

Molecular Weight

Approximately 44.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brpf3 Antibody - middle region
MBS3210007-01 0.1 mL

Brpf3 Antibody - middle region

Sign In for Pricing
View Details
Brpf3 Antibody - middle region
MBS3210007-02 5x 0.1 mL

Brpf3 Antibody - middle region

Sign In for Pricing
View Details
3-Indolyl β-D-cellotrioside
GC7681-10mg 10 mg

3-Indolyl β-D-cellotrioside

Sign In for Pricing
View Details
PD-307243
HY-118172 1 Each

PD-307243

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS520063 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Rabbit Polyclonal NDUFB5 Antibody [PerCP]
NBP2-97853PCP 0.1 mL

Rabbit Polyclonal NDUFB5 Antibody [PerCP]

Sign In for Pricing
View Details