Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Human (His-Trx)

The CHRNA1 Protein undergoes a substantial conformational shift upon acetylcholine binding, influencing all subunits and leading to the activation of an ion-conducting channel. Yet, the acetylcholine receptor alpha subunit of CHRNA1 can be non-functional in certain cases, underscoring the need to comprehend the factors governing its functionality and integration into fully operational acetylcholine-gated cation-selective channels. CHRNA1 Protein, Human (His-Trx) is the recombinant human-derived CHRNA1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Human (His-Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-human-his-trx.html

Purity

90.0

Smiles

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Molecular Formula

1134 (Gene_ID) P02708 (S21-L255) (Accession)

Molecular Weight

Approximately 44.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcyt2 Mouse siRNA Oligo Duplex (Locus ID 68671)
SR413463 1 Kit

Pcyt2 Mouse siRNA Oligo Duplex (Locus ID 68671)

Sign In for Pricing
View Details
GRK5 (G-Protein-Coupled Receptor Kinase 5, GPRK5) (MaxLight 750)
MBS6419355-01 0.1 mL

GRK5 (G-Protein-Coupled Receptor Kinase 5, GPRK5) (MaxLight 750)

Sign In for Pricing
View Details
GRK5 (G-Protein-Coupled Receptor Kinase 5, GPRK5) (MaxLight 750)
MBS6419355-02 5x 0.1 mL

GRK5 (G-Protein-Coupled Receptor Kinase 5, GPRK5) (MaxLight 750)

Sign In for Pricing
View Details
Human ANKRD9 activation kit by CRISPRa
GA114770 1 Kit

Human ANKRD9 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 YADH Polyclonal Antibody
MBS7164058 Inquire

Rabbit anti-Escherichia coli O157:H7 YADH Polyclonal Antibody

Sign In for Pricing
View Details
Human Ferrochelatase, mitochondrial (FECH) ELISA Kit
MBS167188-01 48 Well

Human Ferrochelatase, mitochondrial (FECH) ELISA Kit

Sign In for Pricing
View Details