Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Human (His-Trx)

The CHRNA1 Protein undergoes a substantial conformational shift upon acetylcholine binding, influencing all subunits and leading to the activation of an ion-conducting channel. Yet, the acetylcholine receptor alpha subunit of CHRNA1 can be non-functional in certain cases, underscoring the need to comprehend the factors governing its functionality and integration into fully operational acetylcholine-gated cation-selective channels. CHRNA1 Protein, Human (His-Trx) is the recombinant human-derived CHRNA1 protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Human (His-Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-human-his-trx.html

Purity

90.0

Smiles

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Molecular Formula

1134 (Gene_ID) P02708 (S21-L255) (Accession)

Molecular Weight

Approximately 44.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDZD3 (NM_001168468) Human Tagged Lenti ORF Clone
RC230192L3 10 µg

PDZD3 (NM_001168468) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SMIP004 25mg
A15240-25 25 mg

SMIP004 25mg

Sign In for Pricing
View Details
NFATc1 (NFATc-1, NFATc 1, Nuclear Factor of Activated T-cells c1) (PE)
301419-PE 100 µL

NFATc1 (NFATc-1, NFATc 1, Nuclear Factor of Activated T-cells c1) (PE)

Sign In for Pricing
View Details
Lysosome Associated Membrane Protein 2 (LAMP 2, Igp2, Igp110, CD107b, LAMP2C, LAMPB, Lysosome Associated Membrane Glycoprotein 2 Precursor, MAC3) (MaxLight 650) discontinued
L9190-12D-ML650 100 µL

Lysosome Associated Membrane Protein 2 (LAMP 2, Igp2, Igp110, CD107b, LAMP2C, LAMPB, Lysosome Associated Membrane Glycoprotein 2 Precursor, MAC3) (MaxLight 650) discontinued

Sign In for Pricing
View Details
FBXO39, CT (FBXO39, FBX39, F-box only protein 39) (MaxLight 650) discontinued
035560-ML650 100 µL

FBXO39, CT (FBXO39, FBX39, F-box only protein 39) (MaxLight 650) discontinued

Sign In for Pricing
View Details
MYBL2 (v-myb Myeloblastosis Viral Oncogene Homolog (avian) -like 2, B-MYB, BMYB, MGC15600) (FITC)
249049-FITC 100 µL

MYBL2 (v-myb Myeloblastosis Viral Oncogene Homolog (avian) -like 2, B-MYB, BMYB, MGC15600) (FITC)

Sign In for Pricing
View Details