Recombinant Human Receptor for retinol uptake STRA6 (STRA6), partial
Product Specifications
Product Name Alternative
Retinol-binding protein receptor STRA6; Stimulated by retinoic acid gene 6 protein homolog
Abbreviation
Recombinant Human STRA6 protein, partial
Gene Name
STRA6
UniProt
Q9BX79
Expression Region
1-50aa
Organism
Homo sapiens (Human)
Target Sequence
MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG
Tag
C-terminal hFc1-tagged
Type
In Stock Protein
Source
Mammalian cell
Field of Research
Developmental Biology
Relevance
Functions as retinol transporter. Accepts all-trans retinol from the extracellular retinol-binding protein RBP4, facilitates retinol transport across the cell membrane, and then transfers retinol to the cytoplasmic retinol-binding protein RBP1 (PubMed:9452451, PubMed:18316031, PubMed:22665496) . Retinol uptake is enhanced by LRAT, an enzyme that converts retinol to all-trans retinyl esters, the storage forms of vitamin A (PubMed:18316031, PubMed:22665496) . Contributes to the activation of a signaling cascade that depends on retinol transport and LRAT-dependent generation of retinol metabolites that then trigger activation of JAK2 and its target STAT5, and ultimately increase the expression of SOCS3 and inhibit cellular responses to insulin (PubMed:21368206, PubMed:22665496) . Important for the homeostasis of vitamin A and its derivatives, such as retinoic acid (PubMed:18316031) . STRA6-mediated transport is particularly important in the eye, and under conditions of dietary vitamin A deficiency (Probable) . Does not transport retinoic acid (PubMed:18316031) .
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
34.2 kDa
References & Citations
"Cross talk between signaling and vitamin A transport by the retinol-binding protein receptor STRA6." Berry D.C., O'Byrne S.M., Vreeland A.C., Blaner W.S., Noy N. Mol. Cell. Biol. 32:3164-3175 (2012)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog