Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor for retinol uptake STRA6 (STRA6), partial

Product Specifications

Product Name Alternative

Retinol-binding protein receptor STRA6; Stimulated by retinoic acid gene 6 protein homolog

Abbreviation

Recombinant Human STRA6 protein, partial

Gene Name

STRA6

UniProt

Q9BX79

Expression Region

1-50aa

Organism

Homo sapiens (Human)

Target Sequence

MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Developmental Biology

Relevance

Functions as retinol transporter. Accepts all-trans retinol from the extracellular retinol-binding protein RBP4, facilitates retinol transport across the cell membrane, and then transfers retinol to the cytoplasmic retinol-binding protein RBP1 (PubMed:9452451, PubMed:18316031, PubMed:22665496) . Retinol uptake is enhanced by LRAT, an enzyme that converts retinol to all-trans retinyl esters, the storage forms of vitamin A (PubMed:18316031, PubMed:22665496) . Contributes to the activation of a signaling cascade that depends on retinol transport and LRAT-dependent generation of retinol metabolites that then trigger activation of JAK2 and its target STAT5, and ultimately increase the expression of SOCS3 and inhibit cellular responses to insulin (PubMed:21368206, PubMed:22665496) . Important for the homeostasis of vitamin A and its derivatives, such as retinoic acid (PubMed:18316031) . STRA6-mediated transport is particularly important in the eye, and under conditions of dietary vitamin A deficiency (Probable) . Does not transport retinoic acid (PubMed:18316031) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.2 kDa

References & Citations

"Cross talk between signaling and vitamin A transport by the retinol-binding protein receptor STRA6." Berry D.C., O'Byrne S.M., Vreeland A.C., Blaner W.S., Noy N. Mol. Cell. Biol. 32:3164-3175 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Celf2 (NM_001110228) Mouse Tagged ORF Clone Lentiviral Particle
MR222194L4V 200 µL

Celf2 (NM_001110228) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
(+)-Muscarine Iodide
TRC-M814000-10MG 10 mg

(+)-Muscarine Iodide

Ask
View Details
Hepatocyte Specific Antigen (HRP)
MBS6123238-01 0.1 mL

Hepatocyte Specific Antigen (HRP)

Ask
View Details
Hepatocyte Specific Antigen (HRP)
MBS6123238-02 5x 0.1 mL

Hepatocyte Specific Antigen (HRP)

Ask
View Details
Recombinant Tolumonas auensis Diaminopimelate epimerase (dapF)
MBS1150966-01 0.02 mg (E-Coli)

Recombinant Tolumonas auensis Diaminopimelate epimerase (dapF)

Ask
View Details
Recombinant Tolumonas auensis Diaminopimelate epimerase (dapF)
MBS1150966-02 0.02 mg (Yeast)

Recombinant Tolumonas auensis Diaminopimelate epimerase (dapF)

Ask
View Details