Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A2, Human (HEK293, His)

BTN3A2 Protein, Human (HEK293, His) is a recombinant human BTN3A2 produced in HEK293 cells, with His tag. BTN3A2 is a member of butyrophilin family[1].

Product Specifications

Product Name Alternative

BTN3A2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn3a2-protein-human-hek293-his.html

Smiles

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWHHHHHH

Molecular Formula

11118 (Gene_ID) P78410-1 (Q30-W248) (Accession)

Molecular Weight

Approximately 29 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Magdalena Malinowska, et al. Butyrophilins: an important new element of resistance. Cent Eur J Immunol. 2017; 42 (4) : 399-403.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALK (phospho Tyr1507) Polyclonal Antibody
E44H01169 100 µL

ALK (phospho Tyr1507) Polyclonal Antibody

Sign In for Pricing
View Details
Trans-4-Methyl-L-proline
291038-01 500 mg

Trans-4-Methyl-L-proline

Sign In for Pricing
View Details
Trans-4-Methyl-L-proline
291038-02 1 g

Trans-4-Methyl-L-proline

Sign In for Pricing
View Details
CFTR Antibody
orb1461442-01 20 µg

CFTR Antibody

Sign In for Pricing
View Details
CFTR Antibody
orb1461442-02 100 µg

CFTR Antibody

Sign In for Pricing
View Details
BOS1 Antibody
orb844944 2 mg

BOS1 Antibody

Sign In for Pricing
View Details