Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glucagon receptor (GCGR), partial

Product Specifications

Product Name Alternative

GL-R

Abbreviation

Recombinant Human GCGR protein, partial

Gene Name

GCGR

UniProt

P47871

Expression Region

26-136aa

Organism

Homo sapiens (Human)

Target Sequence

AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Cancer

Relevance

G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.9 kDa

References & Citations

"Role of the glucagon receptor COOH-terminal domain in glucagon-mediated signaling and receptor internalization." Buggy J.J., Heurich R.O., MacDougall M., Kelley K.A., Livingston J.N., Yoo-Warren H., Rossomando A.J. Diabetes 46:1400-1405 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen II Recombinant Rabbit Monoclonal Antibody [PSH06-62]
HA722733 100 µL

Collagen II Recombinant Rabbit Monoclonal Antibody [PSH06-62]

Sign In for Pricing
View Details
Frozen Tissue Sections, Skin
CS500090 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details
CD81 Recombinant Monoclonal Mouse Antibody (2304.81), RPE-AstralTM616 Conjugate - Biotium Choice
P014-R616-500 1x 500 µL

CD81 Recombinant Monoclonal Mouse Antibody (2304.81), RPE-AstralTM616 Conjugate - Biotium Choice

Sign In for Pricing
View Details
DRD2 Human Recombinant Protein, Synthetic Nanodisc
TP721596 10 µg

DRD2 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
2-(Diisopropylamino)ethanol
TRC-D968000-500MG 500 mg

2-(Diisopropylamino)ethanol

Sign In for Pricing
View Details
CF®505 Donkey Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL
#20879-50uL 1x 50 µL

CF®505 Donkey Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL

Sign In for Pricing
View Details