Fas/CD95, Rat (HEK293, His)
Fas receptor is a cell surface death receptor, can bind to Fas ligand to form death-inducing signaling complexes, such as Fas associated death domain proteins (FADD) [1][2]. Fas receptor participates in the caspase cascade and regulate the activation of JNK and p38-K downstream. It is also involved in the signaling cascade of ERK/JNK MAPKs, activating MAPK3/ERK1, MAPK8/JNK and NF-κB, which has been implicated in the pathogenesis of various malignant tumors and immune system diseases[3][4]. Rat Fas receptor contain a death domain (219-303 a.a.) that plays a key role in regulating programmed death. Fas/CD95 Protein, Rat (HEK293, His) has a full length of 149 amino acids (Q22-K170), produced in HEK293 cells with C-terminal 6*His-tag.
Product Specifications
Product Name Alternative
Fas/CD95 Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fas-cd95-protein-rat-hek293-his.html
Purity
97.00
Smiles
QGTDSIFEGLELKRSVRETDNNCSEGLYQVGPFCCQPCQPGERKVKDCTTSGGAPTCHPCTEGEEYTDRKHYSDKCRRCAFCDEGHGLEVETNCTRTQNTKCRCKENFYCNASLCDHCYHCTSCGLEDILEPCTRTSNTKCKKQSSNYK
Molecular Formula
246097 (Gene_ID) Q63199 (Q22-K170) (Accession)
Molecular Weight
Approximately 27-38 kDa due to the glycosylation.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog