Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sortilin/SORT1, Human (HEK293, His)

The Sortilin/SORT1 protein acts as a sorting receptor in the Golgi apparatus and as a clearance receptor on the cell surface. It plays a crucial role in protein transport to lysosomes, independent of M6PR. Sortilin/SORT1 Protein, Human (HEK293, His) is the recombinant human-derived Sortilin/SORT1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Sortilin/SORT1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sortilin-sort1-protein-human-hek293-his.html

Purity

99.00

Smiles

SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSN

Molecular Formula

6272 (Gene_ID) Q99523-1 (S78-N755) (Accession)

Molecular Weight

Approximately 80-110 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PSMG2 activation kit by CRISPRa
GA111318 1 Kit

Human PSMG2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human GPR88 activation kit by CRISPRa
GA110066 1 Kit

Human GPR88 activation kit by CRISPRa

Sign In for Pricing
View Details
MPP1 (NM_001166460) Human Over-expression Lysate
LY433103 100 µg

MPP1 (NM_001166460) Human Over-expression Lysate

Sign In for Pricing
View Details
Metoprine
TRC-M338835-25MG 25 mg

Metoprine

Sign In for Pricing
View Details
Human HDHD2 activation kit by CRISPRa
GA113348 1 Kit

Human HDHD2 activation kit by CRISPRa

Sign In for Pricing
View Details
CKAP2 Human Gene Knockout Kit (CRISPR)
KN415595 1 Kit

CKAP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details