Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sortilin/SORT1, Human (HEK293, His)

The Sortilin/SORT1 protein acts as a sorting receptor in the Golgi apparatus and as a clearance receptor on the cell surface. It plays a crucial role in protein transport to lysosomes, independent of M6PR. Sortilin/SORT1 Protein, Human (HEK293, His) is the recombinant human-derived Sortilin/SORT1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Sortilin/SORT1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sortilin-sort1-protein-human-hek293-his.html

Purity

99.00

Smiles

SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSN

Molecular Formula

6272 (Gene_ID) Q99523-1 (S78-N755) (Accession)

Molecular Weight

Approximately 80-110 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filaggrin (Keratinocyte Differentiation Marker) (rFLG/1561), CF647 conjugate, 0.1mg/mL
BNC471946-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (rFLG/1561), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ISM1 (NM_080826) Human Recombinant Protein
TP322172M 100 µg

ISM1 (NM_080826) Human Recombinant Protein

Sign In for Pricing
View Details
Human AHDC1 activation kit by CRISPRa
GA109081 1 Kit

Human AHDC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human HEMK1 activation kit by CRISPRa
GA109792 1 Kit

Human HEMK1 activation kit by CRISPRa

Sign In for Pricing
View Details
FATP2 (SLC27A2) Rabbit Polyclonal Antibody
TA365020 100 µL

FATP2 (SLC27A2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Lycopersicon esculentum Lectin (Tomato) -LEA-
LA-7001-1 1 mg

Alkaline Phosphatase Conjugated Lycopersicon esculentum Lectin (Tomato) -LEA-

Sign In for Pricing
View Details