Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sortilin/SORT1, Human (HEK293, His)

The Sortilin/SORT1 protein acts as a sorting receptor in the Golgi apparatus and as a clearance receptor on the cell surface. It plays a crucial role in protein transport to lysosomes, independent of M6PR. Sortilin/SORT1 Protein, Human (HEK293, His) is the recombinant human-derived Sortilin/SORT1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Sortilin/SORT1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sortilin-sort1-protein-human-hek293-his.html

Purity

99.00

Smiles

SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSN

Molecular Formula

6272 (Gene_ID) Q99523-1 (S78-N755) (Accession)

Molecular Weight

Approximately 80-110 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT1 Human Knockdown Lysate
LY300300 100 µg

STAT1 Human Knockdown Lysate

Sign In for Pricing
View Details
HLA-DQ (MHC II) (HLA-DQA1/2866R), CF647 conjugate, 0.1mg/mL
BNC472866-100 1x 100 µL

HLA-DQ (MHC II) (HLA-DQA1/2866R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ING2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G10]
TA800665BM 100 µL

ING2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G10]

Sign In for Pricing
View Details
2,3,4-Tri-O-acetyl-D-xylopyranose
TRC-T767020-50MG 50 mg

2,3,4-Tri-O-acetyl-D-xylopyranose

Sign In for Pricing
View Details
1700037C18Rik Mouse Gene Knockout Kit (CRISPR)
KN500141 1 Kit

1700037C18Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MHC II, Mouse (MK-D6), Biotin conjugate, 0.1mg/mL
BNCB2007-500 1x 500 µL

MHC II, Mouse (MK-D6), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details