Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sortilin/SORT1, Human (HEK293, His)

The Sortilin/SORT1 protein acts as a sorting receptor in the Golgi apparatus and as a clearance receptor on the cell surface. It plays a crucial role in protein transport to lysosomes, independent of M6PR. Sortilin/SORT1 Protein, Human (HEK293, His) is the recombinant human-derived Sortilin/SORT1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Sortilin/SORT1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sortilin-sort1-protein-human-hek293-his.html

Purity

99.00

Smiles

SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSN

Molecular Formula

6272 (Gene_ID) Q99523-1 (S78-N755) (Accession)

Molecular Weight

Approximately 80-110 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-hsa-miR-6751-3p Vector
mh42375 500 ng

LentimiRa-hsa-miR-6751-3p Vector

Sign In for Pricing
View Details
AGTPBP1 Protein Vector (Rat) (pPM-C-HA)
11542026 500 ng

AGTPBP1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
LCE1K Adenovirus (Mouse)
61126054 1.0 mL

LCE1K Adenovirus (Mouse)

Sign In for Pricing
View Details
HIST1H2AB Antibody Blocking peptide
orb1457529 500 µg

HIST1H2AB Antibody Blocking peptide

Sign In for Pricing
View Details
CADM1 (IGSF4, IGSF4A, NECL2, SYNCAM, TSLC1, Cell Adhesion Molecule 1, Immunoglobulin Superfamily Member 4, Nectin-like Protein 2, Spermatogenic Immunoglobulin Superfamily, Synaptic Cell Adhesion Molecule, Tumor Suppressor in Lung Cancer 1, SgIgSF, SynCAM, NECL-2, TSLC-1)
124239-FITC 100 µL

CADM1 (IGSF4, IGSF4A, NECL2, SYNCAM, TSLC1, Cell Adhesion Molecule 1, Immunoglobulin Superfamily Member 4, Nectin-like Protein 2, Spermatogenic Immunoglobulin Superfamily, Synaptic Cell Adhesion Molecule, Tumor Suppressor in Lung Cancer 1, SgIgSF, SynCAM, NECL-2, TSLC-1)

Sign In for Pricing
View Details
Rabbit Polyclonal STPG4 Antibody [DyLight 650]
NBP3-06297C 0.1 mL

Rabbit Polyclonal STPG4 Antibody [DyLight 650]

Sign In for Pricing
View Details