Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ING5, Human (His)

The ING5 protein is a key component of the HBO1 complex and mediates H3K14ac and H4 acetylation. In the MOZ/MORF complex, it exhibits histone H3 acetyltransferase activity and may regulate DNA replication and act as a transcriptional coactivator. ING5 Protein, Human (His) is the recombinant human-derived ING5 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

ING5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ing5-protein-human-gst.html

Purity

98.0

Smiles

EDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQ

Molecular Formula

84289 (Gene_ID) Q8WYH8-2 (E36-Q84) (Accession)

Molecular Weight

Approximately 7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ALG11, CT (ALG11, GT8, GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase, Asparagine-linked glycosylation protein 11 homolog, Glycolipid 2-alpha-mannosyltransferase) (PE)
MBS6272904-01 0.2 mL

ALG11, CT (ALG11, GT8, GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase, Asparagine-linked glycosylation protein 11 homolog, Glycolipid 2-alpha-mannosyltransferase) (PE)

Ask
View Details
ALG11, CT (ALG11, GT8, GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase, Asparagine-linked glycosylation protein 11 homolog, Glycolipid 2-alpha-mannosyltransferase) (PE)
MBS6272904-02 5x 0.2 mL

ALG11, CT (ALG11, GT8, GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase, Asparagine-linked glycosylation protein 11 homolog, Glycolipid 2-alpha-mannosyltransferase) (PE)

Ask
View Details
GPR64 (ADGRG2) (NM_001184837) Human Tagged ORF Clone Lentiviral Particle
RC230601L4V 200 µL

GPR64 (ADGRG2) (NM_001184837) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Recombinant Human BRSK2 Protein - (Dry Ice)
H00009024-P01-10ug 10 µg

Recombinant Human BRSK2 Protein - (Dry Ice)

Ask
View Details
ABflo® 647 Rabbit anti-Human LAMP1/CD107a mAb
A22068-01 50 Tests

ABflo® 647 Rabbit anti-Human LAMP1/CD107a mAb

Ask
View Details
ABflo® 647 Rabbit anti-Human LAMP1/CD107a mAb
A22068-02 100 Tests

ABflo® 647 Rabbit anti-Human LAMP1/CD107a mAb

Ask
View Details