Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ING5, Human (His)

The ING5 protein is a key component of the HBO1 complex and mediates H3K14ac and H4 acetylation. In the MOZ/MORF complex, it exhibits histone H3 acetyltransferase activity and may regulate DNA replication and act as a transcriptional coactivator. ING5 Protein, Human (His) is the recombinant human-derived ING5 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

ING5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ing5-protein-human-gst.html

Purity

98.0

Smiles

EDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQ

Molecular Formula

84289 (Gene_ID) Q8WYH8-2 (E36-Q84) (Accession)

Molecular Weight

Approximately 7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P. Aeruginosa antigens O1, O2, O3, O4 and O5 (group A) Mouse Monoclonal Antibody
orb1402030-01 100 µg

P. Aeruginosa antigens O1, O2, O3, O4 and O5 (group A) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
P. Aeruginosa antigens O1, O2, O3, O4 and O5 (group A) Mouse Monoclonal Antibody
orb1402030-02 1 mg

P. Aeruginosa antigens O1, O2, O3, O4 and O5 (group A) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SLC38A4 Antibody [CoraFluor 1]
NBP2-81807CL1 0.1 mL

Rabbit Polyclonal SLC38A4 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
ER Membrane Protein Complex Subunit 1 (EMC1) Antibody
abx036785-01 100 µg

ER Membrane Protein Complex Subunit 1 (EMC1) Antibody

Sign In for Pricing
View Details
ER Membrane Protein Complex Subunit 1 (EMC1) Antibody
abx036785-02 1 mg

ER Membrane Protein Complex Subunit 1 (EMC1) Antibody

Sign In for Pricing
View Details
KIF2A Recombinant Protein (Mouse)
RP145721 100 µg

KIF2A Recombinant Protein (Mouse)

Sign In for Pricing
View Details