Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ING5, Human (His)

The ING5 protein is a key component of the HBO1 complex and mediates H3K14ac and H4 acetylation. In the MOZ/MORF complex, it exhibits histone H3 acetyltransferase activity and may regulate DNA replication and act as a transcriptional coactivator. ING5 Protein, Human (His) is the recombinant human-derived ING5 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

ING5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ing5-protein-human-gst.html

Purity

98.0

Smiles

EDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQ

Molecular Formula

84289 (Gene_ID) Q8WYH8-2 (E36-Q84) (Accession)

Molecular Weight

Approximately 7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tm6sf2 ORF Vector (Mouse) (pORF)
46801014 1.0 µg DNA

Tm6sf2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
BRAF Recombinant Antibody, FITC Conjugated
bsm-63118R-FITC 100 µL

BRAF Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
Defb43 (NM_001037528) Rat Tagged ORF Clone Lentiviral Particle
RR202208L4V 200 µL

Defb43 (NM_001037528) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
3,4-Dichlorophenylacetic acid
OR0359 1 Each

3,4-Dichlorophenylacetic acid

Sign In for Pricing
View Details
Phospho-SHP-1 (Tyr564) Cell-Based ELISA Kit
CBP1730 1 Kit

Phospho-SHP-1 (Tyr564) Cell-Based ELISA Kit

Sign In for Pricing
View Details
TMEM126A Polyclonal Antibody
RD87548A-01 60 μL

TMEM126A Polyclonal Antibody

Sign In for Pricing
View Details