Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P-Selectin, Rat (HEK293, His)

P-Selectin, a Ca (2+) -dependent receptor on myeloid cells, binds to neutrophils and monocytes via carbohydrates. It interacts with SELPLG to enable rapid leukocyte rolling over vascular surfaces in early inflammation. P-Selectin also interacts with SNX17 and promotes neutrophil adhesion and rolling, requiring SELPLG's sialyl-Lewis X and tyrosine sulfation. P-Selectin Protein, Rat (HEK293, His) is the recombinant rat-derived P-Selectin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

P-Selectin Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/p-selectin-protein-rat-hek293-his.html

Purity

97.0

Smiles

WTYNYSTKAYSWNNSRAFCKRHFTDLVAIQNKNEIAHLNDVIPYVNSYYWIGIRKINNKWTWVGTNKTLTAEAENWADNEPNNKRNNQDCVEIYIKSNSAPGKWNDEPCFKRKRALCYTASCQDMSCNSQGERIETIGSYTCSCYPGFYGPECEYVQECGKFDIPQHVLMNCSHPLGDFSFSSQCTFSCPEGYDLNGPSEMQCLASGIWTNNPPQCKAVQCQSLEAPLHGTMDCTHPLAAFAYDSSCKFECQPGYRMRGSDILHCTDSGQWSEPLPTCEAIACEPLESPLHGSMDCFPSTGAFGYNSSCTFRCTEGFVLMGNDAIHCADLGQWTAPAPVCEALQCQEFPVPSKAQVSCSDPFGPLKYQSACSFSCDEGSLLVGASVIRCLATGHWSEAPPECQAVSCTPLLSPENGTMTCIQPLGHSNYKSTCQFMCDEGFYLSGPERLDCSPSGHWTGSPPMCEAIKCPEIFAPEQGSLDCSHVHGEFSVGSTCHFSCNEEFELLGSRNVECTVSGRWSAPPPTCKGVTSLPVPSVRCPALTTPGQGTMSCRHHLESFGPNTTCYFGCKTGFTLRGANSLRCGASGQWTAVTPVCRAVKCSELHMDTAVAMNCSNPWGNFSYGSTCAFHCPEGQSLNGSARTTCGEDGHWSDAMPTCQ

Molecular Formula

25651 (Gene_ID) P98106/AAI01920.1 (W42-Q700) (Accession)

Molecular Weight

Approximately 115 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF647 conjugate, 0.1mg/mL
BNC471045-500 1x 500 µL

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF740 conjugate, 0.1mg/mL
BNC741099-500 1x 500 µL

CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDX2 (GI Epithelial Marker) (CDX2/2951R), CF740 conjugate, 0.1mg/mL
BNC742951-500 1x 500 µL

CDX2 (GI Epithelial Marker) (CDX2/2951R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10), CF640R conjugate, 0.1mg/mL
BNC400640-100 1x 100 µL

CD34 (QBEnd/10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details