Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P-Selectin, Rat (HEK293, His)

P-Selectin, a Ca (2+) -dependent receptor on myeloid cells, binds to neutrophils and monocytes via carbohydrates. It interacts with SELPLG to enable rapid leukocyte rolling over vascular surfaces in early inflammation. P-Selectin also interacts with SNX17 and promotes neutrophil adhesion and rolling, requiring SELPLG's sialyl-Lewis X and tyrosine sulfation. P-Selectin Protein, Rat (HEK293, His) is the recombinant rat-derived P-Selectin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

P-Selectin Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/p-selectin-protein-rat-hek293-his.html

Purity

97.0

Smiles

WTYNYSTKAYSWNNSRAFCKRHFTDLVAIQNKNEIAHLNDVIPYVNSYYWIGIRKINNKWTWVGTNKTLTAEAENWADNEPNNKRNNQDCVEIYIKSNSAPGKWNDEPCFKRKRALCYTASCQDMSCNSQGERIETIGSYTCSCYPGFYGPECEYVQECGKFDIPQHVLMNCSHPLGDFSFSSQCTFSCPEGYDLNGPSEMQCLASGIWTNNPPQCKAVQCQSLEAPLHGTMDCTHPLAAFAYDSSCKFECQPGYRMRGSDILHCTDSGQWSEPLPTCEAIACEPLESPLHGSMDCFPSTGAFGYNSSCTFRCTEGFVLMGNDAIHCADLGQWTAPAPVCEALQCQEFPVPSKAQVSCSDPFGPLKYQSACSFSCDEGSLLVGASVIRCLATGHWSEAPPECQAVSCTPLLSPENGTMTCIQPLGHSNYKSTCQFMCDEGFYLSGPERLDCSPSGHWTGSPPMCEAIKCPEIFAPEQGSLDCSHVHGEFSVGSTCHFSCNEEFELLGSRNVECTVSGRWSAPPPTCKGVTSLPVPSVRCPALTTPGQGTMSCRHHLESFGPNTTCYFGCKTGFTLRGANSLRCGASGQWTAVTPVCRAVKCSELHMDTAVAMNCSNPWGNFSYGSTCAFHCPEGQSLNGSARTTCGEDGHWSDAMPTCQ

Molecular Formula

25651 (Gene_ID) P98106/AAI01920.1 (W42-Q700) (Accession)

Molecular Weight

Approximately 115 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMEM, Low Glucose
CM016-300 6x 500 mL

DMEM, Low Glucose

Sign In for Pricing
View Details
Commd6 (NM_001109105) Rat Tagged ORF Clone
RR207337 10 µg

Commd6 (NM_001109105) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit TAK1 Antibody
orb1527562-01 10 µL

Rabbit TAK1 Antibody

Sign In for Pricing
View Details
Rabbit TAK1 Antibody
orb1527562-02 100 µL

Rabbit TAK1 Antibody

Sign In for Pricing
View Details
P2RY13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1583105 3x 1.0 µg

P2RY13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
IGF1R/CD221 Protein, Human, Recombinant (aa 31-932, His & Avi), Biotinylated
TMPK-00456-01 5 µg

IGF1R/CD221 Protein, Human, Recombinant (aa 31-932, His & Avi), Biotinylated

Sign In for Pricing
View Details