Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anti-CaMKII alpha antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

[CAMK2A]

NCBI Gene ID

815

Reactivity

Human, Mouse, Rat<br>No cross reactivity with other proteins.

Storage Conditions

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Other Gene Names

[CAMK2A; CAMK2A; CAMKA; MRD53; CAMKA; KIAA0968; CaM kinase II subunit alpha; CaMK-II subunit alpha]

Short Name

[CaMKII alpha]

Other Product Names

[calcium/calmodulin-dependent protein kinase type II subunit alpha isoform 2; Calcium/calmodulin-dependent protein kinase type II subunit alpha; calcium/calmodulin-dependent protein kinase type II subunit alpha; calcium/calmodulin dependent protein kinase II alpha]

NCBI GI Number

25952118

NCBI Accession Number

NP_741960.1

NCBI GB Accession Number

NM_171825.2

Uniprot Accession Number

Q9UQM7

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eliglustat-d15 (tartrate)
HY-14885S-01 1 mg

Eliglustat-d15 (tartrate)

Sign In for Pricing
View Details
Eliglustat-d15 (tartrate)
HY-14885S-02 5 mg

Eliglustat-d15 (tartrate)

Sign In for Pricing
View Details
Bovine Milk fat globule-EGF Factor 8 Protein, MFGE8 GENLISA ELISA
KLB2234 96 Well

Bovine Milk fat globule-EGF Factor 8 Protein, MFGE8 GENLISA ELISA

Sign In for Pricing
View Details
CD5 Antigen-like (scavenger Receptor Cysteine Rich Family) (CD5L) Rabbit anti-Human Polyclonal (N-Terminus) Antibody
GWB-12F24C 0.05 mg

CD5 Antigen-like (scavenger Receptor Cysteine Rich Family) (CD5L) Rabbit anti-Human Polyclonal (N-Terminus) Antibody

Sign In for Pricing
View Details
UMPS antibody
70R-2670 50 ug

UMPS antibody

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MF-0155879-01 5 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details