Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB, Rat (His)

PDGF-BB Protein, Rat is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor.

Product Specifications

Product Name Alternative

PDGF-BB Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-bb-protein-rat-his.html

Purity

96.20

Smiles

MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT

Molecular Formula

24628 (Gene_ID) Q05028 (S74-T182) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phalloidin, CF®680R, 50 U
#00048-T 1x 50 U

Phalloidin, CF®680R, 50 U

Sign In for Pricing
View Details
PMEPA1 / TMEPAI (Tumor Suppressor Oncoprotein) (PMEPA1/2697), CF640R conjugate, 0.1mg/mL
BNC402697-500 1x 500 µL

PMEPA1 / TMEPAI (Tumor Suppressor Oncoprotein) (PMEPA1/2697), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXD4L5 Human Gene Knockout Kit (CRISPR)
KN425654 1 Kit

FOXD4L5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nucleostemin (GNL3) (C-term) Rabbit Polyclonal Antibody
AP11354PU-N 400 µL

Nucleostemin (GNL3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MPEG-2000-DSPE
TRC-M745845-500MG 500 mg

MPEG-2000-DSPE

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF640R conjugate, 0.1mg/mL
BNC402345-100 1x 100 µL

CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details