Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB, Rat (His)

PDGF-BB Protein, Rat is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor.

Product Specifications

Product Name Alternative

PDGF-BB Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-bb-protein-rat-his.html

Purity

96.20

Smiles

MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT

Molecular Formula

24628 (Gene_ID) Q05028 (S74-T182) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ximelagatran-d11
TRC-X745002-10MG 10 mg

Ximelagatran-d11

Sign In for Pricing
View Details
DPP1 (CTSC) (NM_001814) Human Recombinant Protein
TP314863M 100 µg

DPP1 (CTSC) (NM_001814) Human Recombinant Protein

Sign In for Pricing
View Details
Idh2 Mouse Gene Knockout Kit (CRISPR)
KN308084BN 1 Kit

Idh2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IRE1 (ERN1) Human Gene Knockout Kit (CRISPR)
KN415023 1 Kit

IRE1 (ERN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IL-12B p40 Recombinant Rabbit Monoclonal Antibody [PSH02-57] - BSA and Azide free (Capture)
HA721834 100 µL

Human IL-12B p40 Recombinant Rabbit Monoclonal Antibody [PSH02-57] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
Dermokine (DMKN) (NM_001190347) Human Over-expression Lysate
LC434240 20 µg

Dermokine (DMKN) (NM_001190347) Human Over-expression Lysate

Sign In for Pricing
View Details