Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB, Rat (His)

PDGF-BB Protein, Rat is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor.

Product Specifications

Product Name Alternative

PDGF-BB Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-bb-protein-rat-his.html

Purity

96.20

Smiles

MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT

Molecular Formula

24628 (Gene_ID) Q05028 (S74-T182) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALS2CR12 Antibody
E19-9204-1 50 µg - 50 µL

ALS2CR12 Antibody

Sign In for Pricing
View Details
SRRM4 CRISPRa sgRNA lentivector (set of three targets)(Human)
45506121 3x 1.0µg DNA

SRRM4 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Anti-NMI Antibody Picoband® (monoclonal, 2F3)
M02768 100 µg/Vial

Anti-NMI Antibody Picoband® (monoclonal, 2F3)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila Arginine--tRNA ligase (argS), partial
MBS1469118 Inquire

Recombinant Pseudomonas entomophila Arginine--tRNA ligase (argS), partial

Sign In for Pricing
View Details
Mouse CD3E Antibody , APC
E55A08150 50 Tests

Mouse CD3E Antibody , APC

Sign In for Pricing
View Details
KRTAP10-1 (NM_198691) Human Over-expression Lysate
LS386677-100ug 100 µg

KRTAP10-1 (NM_198691) Human Over-expression Lysate

Sign In for Pricing
View Details