Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IL23A&IL12B Heterodimer Protein (Active)

Product Specifications

Product Name Alternative

SGRF; IL-23p19; CLMF p40; IL-12 subunit p40; NKSF2

Abbreviation

Recombinant Human IL23A&IL12B Heterodimer protein (Active)

Gene Name

IL-23

UniProt

Q9NPF7 & P29460

Expression Region

20-189aa&23-328aa

Organism

Homo sapiens (Human)

Target Sequence

RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIW STDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Tag

C-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Interleukin 23 (IL-23) is a heterodimeric cytokine composed of two disulfide-linked subunits, a p19 subunit that is unique to IL-23, and a p40 subunit that is shared with IL-12. The p19 subunit has homology to the p35 subunit of IL-12, as well as to other single chain cytokines such as IL-6 and IL-11. The p40 subunit is homologous to the extracellular domains of the hematopoietic cytokine receptors. Although p19 is expressed by activated macrophages, dendritic cells, T cells, and endothelial cells, only activated macrophages and dendritic cells express p40 concurrently to produce IL-23. IL-23 has biological activities that are similar to, but distinct from IL-12. Both IL-12 and IL-23 induce proliferation and IFN-gamma production by human T cells. While IL-12 acts on both naive and memory human T cells, the effects of IL-23 is restricted to memory T cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by its ability to induce STAT reporter activity in 293F human embryonic kidney cells is 70-210 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Heterodimer

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Inhibitor of Apoptosis Protein Like Protein2 ELISA Kit
MBS019378 Inquire

Chicken Inhibitor of Apoptosis Protein Like Protein2 ELISA Kit

Sign In for Pricing
View Details
Nucleolin (NCL, C23, FLJ45706, FLJ59041, Protein C23)
N6945 100 µL

Nucleolin (NCL, C23, FLJ45706, FLJ59041, Protein C23)

Sign In for Pricing
View Details
PSMC3 (26S Protease Regulatory Subunit 6A, Proteasome 26S Subunit ATPase 3, 26S Proteasome AAA-ATPase Subunit RPT5, Tat-binding Protein 1, TBP-1, Proteasome Subunit P50, TBP1) (FITC)
MBS6391146-01 0.1 mL

PSMC3 (26S Protease Regulatory Subunit 6A, Proteasome 26S Subunit ATPase 3, 26S Proteasome AAA-ATPase Subunit RPT5, Tat-binding Protein 1, TBP-1, Proteasome Subunit P50, TBP1) (FITC)

Sign In for Pricing
View Details
PSMC3 (26S Protease Regulatory Subunit 6A, Proteasome 26S Subunit ATPase 3, 26S Proteasome AAA-ATPase Subunit RPT5, Tat-binding Protein 1, TBP-1, Proteasome Subunit P50, TBP1) (FITC)
MBS6391146-02 5x 0.1 mL

PSMC3 (26S Protease Regulatory Subunit 6A, Proteasome 26S Subunit ATPase 3, 26S Proteasome AAA-ATPase Subunit RPT5, Tat-binding Protein 1, TBP-1, Proteasome Subunit P50, TBP1) (FITC)

Sign In for Pricing
View Details
LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A, FLJ10337, FLJ41617, KIAA1437, LRRC8) (MaxLight 490)
248327-ML490 100 µL

LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A, FLJ10337, FLJ41617, KIAA1437, LRRC8) (MaxLight 490)

Sign In for Pricing
View Details
IFNB1 (Interferon beta, IFN-beta, Fibroblast Interferon, IFB, IFNB) (MaxLight 405) discontinued
143585-ML405 100 µL

IFNB1 (Interferon beta, IFN-beta, Fibroblast Interferon, IFB, IFNB) (MaxLight 405) discontinued

Sign In for Pricing
View Details