Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Complement C5a, Mouse

Complement C5a Protein, Mouse is a recombinant mouse complement component 5a (C5a) . C5a is a potent pro-inflammatory mediator and acts as an essential part of the innate immune response[1].

Product Specifications

Product Name Alternative

Complement C5a Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/complement-c5-c5a-protein-mouse.html

Purity

98.00

Smiles

NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR

Molecular Formula

15139 (Gene_ID) P06684 (N679-R755) (Accession)

Molecular Weight

Approximately 9 kDa

References & Citations

[1]Helga D Manthey, et al. Complement component 5a (C5a) . Int J Biochem Cell Biol. 2009 Nov;41 (11) :2114-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ApoA-I (464CT10.4.4)
sc-517307 100 µg/mL

ApoA-I (464CT10.4.4)

Sign In for Pricing
View Details
Pepinemab (Anti-SEMA4D / CD100)
C00175-1mg*25 25x 1mg

Pepinemab (Anti-SEMA4D / CD100)

Sign In for Pricing
View Details
Recombinant Human Arylacetamide deacetylase (AADAC)
RPC29864-01 20 µg

Recombinant Human Arylacetamide deacetylase (AADAC)

Sign In for Pricing
View Details
Recombinant Human Arylacetamide deacetylase (AADAC)
RPC29864-02 100 µg

Recombinant Human Arylacetamide deacetylase (AADAC)

Sign In for Pricing
View Details
CUDA disodium
T206289-01 10 mg

CUDA disodium

Sign In for Pricing
View Details
CUDA disodium
T206289-02 50 mg

CUDA disodium

Sign In for Pricing
View Details