Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DRB1, Human (Myc, His-SUMO)

HLA-DRB1 protein, as the beta chain of MHCII, guides T cell recognition, orchestrates immune responses against pathogens and tumors, and adapts its antigen presentation in the tumor microenvironment, ensuring a diverse role in immune responses and tolerance mechanisms, notably influenced by specific alleles like DRB1*01:01. HLA-DRB1 Protein, Human (Myc, His-SUMO) is the recombinant human-derived HLA-DRB1 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

HLA-DRB1 Protein, Human (Myc, His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hla-drb1-protein-human-myc-his-sumo.html

Purity

94.00

Smiles

GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK

Molecular Formula

3123 (Gene_ID) P01911 (G30-K227) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BDNF Recombinant Protein
OPCD01619-50UG 50 µg

BDNF Recombinant Protein

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces Pombe SPBPB21E7.05 Protein (aa 1-127)
VAng-Yyj6542-1mgEcoli 1 mg (E. coli)

Recombinant Schizosaccharomyces Pombe SPBPB21E7.05 Protein (aa 1-127)

Sign In for Pricing
View Details
TEAD1 Rabbit mAb
E60M3426 100 µL

TEAD1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae gsiC Protein (aa 1-306)
VAng-Lsx07424-inquire Inquire

Recombinant Shigella Dysenteriae gsiC Protein (aa 1-306)

Sign In for Pricing
View Details
IPO8 (Importin 8, FLJ26580, RANBP8) (FITC)
247672-FITC 100 µL

IPO8 (Importin 8, FLJ26580, RANBP8) (FITC)

Sign In for Pricing
View Details
Phospho-Tau (Thr231) Rabbit Monoclonal Antibody (Capture)
E56PA0593 100 µL

Phospho-Tau (Thr231) Rabbit Monoclonal Antibody (Capture)

Sign In for Pricing
View Details