Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IFN-gamma, Human (His)

IFN-gamma Protein is a dimeric soluble cytokine. It exerts antibacterial, antiviral and antitumor effects through JAK-STAT, mTOR, MAPK and PI3K/AKT signaling pathways. Animal-Free IFN-gamma Protein, Human (His) is the recombinant human-derived animal-FreeIFN-gamma protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IFN-gamma Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ifn-gamma-protein-human-his.html

Purity

95.0

Smiles

MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ

Molecular Formula

3458 (Gene_ID) P01579 (Q24-Q166) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hisamatsu H, et al. Newly identified pair of proteasomal subunits regulated reciprocally by interferon gamma. J Exp Med. 1996 Apr 1;183 (4) :1807-16.|[2]Akiyama K, et al. Replacement of proteasome subunits X and Y by LMP7 and LMP2 induced by interferon-gamma for acquirement of the functional diversity responsible for antigen processing. FEBS Lett. 1994 Apr 18;343 (1) :85-8.|[3]Platanias LC, et al. Mechanisms of type-I- and type-II-interferon-mediated signalling. Nat Rev Immunol. 2005 May;5 (5) :375-86.|[4]Bhat MY, et al A. Comprehensive network map of interferon gamma signaling. J Cell Commun Signal. 2018 Dec;12 (4) :745-751.|[5]Lah TT, et al. Gamma-interferon causes a selective induction of the lysosomal proteases, cathepsins B and L, in macrophages. FEBS Lett. 1995 Apr 17;363 (1-2) :85-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LLPH activation kit by CRISPRa
GA113493 1 Kit

Human LLPH activation kit by CRISPRa

Sign In for Pricing
View Details
CT47A7 (NM_001080140) Human Over-expression Lysate
LY421596 100 µg

CT47A7 (NM_001080140) Human Over-expression Lysate

Sign In for Pricing
View Details
4-(2-Phthalimidoethoxy)acetoacetic Acid Ethyl Ester
TRC-P384570-25MG 25 mg

4-(2-Phthalimidoethoxy)acetoacetic Acid Ethyl Ester

Sign In for Pricing
View Details
2-Octadecyleicosanoic Acid
TRC-O235960-50MG 50 mg

2-Octadecyleicosanoic Acid

Sign In for Pricing
View Details
CD38 Human Gene Knockout Kit (CRISPR)
KN203179LP 1 Kit

CD38 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Laminin (A5), CF740 conjugate, 0.1mg/mL
BNC740308-100 1x 100 µL

Laminin (A5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details