Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Human (CHO)

IL-10 Protein, Human (CHO) is a CHO cell derived anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

Product Specifications

Product Name Alternative

IL-10 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-human-cho.html

Purity

98.0

Smiles

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Formula

3586 (Gene_ID) P22301 (S19-N178) (Accession)

Molecular Weight

Approximately 10-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Fedorak RN, et al. Recombinant human interleukin 10 in the treatment of patients with mild to moderately active Crohn's disease. The Interleukin 10 Inflammatory Bowel Disease Cooperative Study Group. Gastroenterology. 2000 Dec;119 (6) :1473-82.|[2]Chakraborty A, et al. Pharmacodynamic interaction of recombinant human interleukin-10 and prednisolone using in vitro whole blood lymphocyte proliferation. J Pharm Sci. 2002 May;91 (5) :1334-42.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal PP2C gamma/PPM1G Antibody (OTI1C12) [FITC]
NBP2-73552F 0.1 mL

Mouse Monoclonal PP2C gamma/PPM1G Antibody (OTI1C12) [FITC]

Ask
View Details
Mouse Anti Human Glia Maturation Factor Beta
MBS146975-01 0.005 mg

Mouse Anti Human Glia Maturation Factor Beta

Ask
View Details
Mouse Anti Human Glia Maturation Factor Beta
MBS146975-02 0.02 mg

Mouse Anti Human Glia Maturation Factor Beta

Ask
View Details
Mouse Anti Human Glia Maturation Factor Beta
MBS146975-03 0.1 mg

Mouse Anti Human Glia Maturation Factor Beta

Ask
View Details
Mouse Anti Human Glia Maturation Factor Beta
MBS146975-04 5x 0.1 mg

Mouse Anti Human Glia Maturation Factor Beta

Ask
View Details
DENV-3 NS3 Recombinant Protein (N-His-SUMO)
VK694042-01 50 µg

DENV-3 NS3 Recombinant Protein (N-His-SUMO)

Ask
View Details