Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Human (CHO)

IL-10 Protein, Human (CHO) is a CHO cell derived anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

Product Specifications

Product Name Alternative

IL-10 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-human-cho.html

Purity

98.0

Smiles

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Formula

3586 (Gene_ID) P22301 (S19-N178) (Accession)

Molecular Weight

Approximately 10-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Fedorak RN, et al. Recombinant human interleukin 10 in the treatment of patients with mild to moderately active Crohn's disease. The Interleukin 10 Inflammatory Bowel Disease Cooperative Study Group. Gastroenterology. 2000 Dec;119 (6) :1473-82.|[2]Chakraborty A, et al. Pharmacodynamic interaction of recombinant human interleukin-10 and prednisolone using in vitro whole blood lymphocyte proliferation. J Pharm Sci. 2002 May;91 (5) :1334-42.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Olfr201 Mouse siRNA Oligo Duplex (Locus ID 258996)
SR409249 1 Kit

Olfr201 Mouse siRNA Oligo Duplex (Locus ID 258996)

Ask
View Details
Human TXNDC11 Pre-designed siRNA Set B
SI017638B 1 Each

Human TXNDC11 Pre-designed siRNA Set B

Ask
View Details
DMEM/F-12 With L-glutamine and low glucose. W/O glycine, hypoxanthine, thymidine and sodium bicarbonate.
DFP04-50LT 50 L

DMEM/F-12 With L-glutamine and low glucose. W/O glycine, hypoxanthine, thymidine and sodium bicarbonate.

Ask
View Details
ZNFN1A1 Peptide - middle region
MBS3226170-01 0.1 mg

ZNFN1A1 Peptide - middle region

Ask
View Details
ZNFN1A1 Peptide - middle region
MBS3226170-02 5x 0.1 mg

ZNFN1A1 Peptide - middle region

Ask
View Details
Rabbit Monoclonal PDRG1 Antibody (016) [Alexa Fluor 647]
NBP2-90269AF647 0.1 mL

Rabbit Monoclonal PDRG1 Antibody (016) [Alexa Fluor 647]

Ask
View Details