Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Human (CHO)

IL-10 Protein, Human (CHO) is a CHO cell derived anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

Product Specifications

Product Name Alternative

IL-10 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-human-cho.html

Purity

98.0

Smiles

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Formula

3586 (Gene_ID) P22301 (S19-N178) (Accession)

Molecular Weight

Approximately 10-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Fedorak RN, et al. Recombinant human interleukin 10 in the treatment of patients with mild to moderately active Crohn's disease. The Interleukin 10 Inflammatory Bowel Disease Cooperative Study Group. Gastroenterology. 2000 Dec;119 (6) :1473-82.|[2]Chakraborty A, et al. Pharmacodynamic interaction of recombinant human interleukin-10 and prednisolone using in vitro whole blood lymphocyte proliferation. J Pharm Sci. 2002 May;91 (5) :1334-42.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-ASB-4 Rabbit pAb
GB115063-100 100 μL

Anti-ASB-4 Rabbit pAb

Ask
View Details
Krt16 Mouse shRNA Lentiviral Particle (Locus ID 16666)
TL511309V 500 µL Each

Krt16 Mouse shRNA Lentiviral Particle (Locus ID 16666)

Ask
View Details
PMS2LP1 CRISPR Knock Out 293T Cell Line (Human)
66030141 1x 10^6 Cells / 1.0 mL

PMS2LP1 CRISPR Knock Out 293T Cell Line (Human)

Ask
View Details
Lentiviral mouse Apoa1 shRNA (UAS) - Lentiviral mouse Apoa1 shRNA (UAS) (100)
GTR15259866 1 Vial

Lentiviral mouse Apoa1 shRNA (UAS) - Lentiviral mouse Apoa1 shRNA (UAS) (100)

Ask
View Details