IL-10, Human (CHO)
IL-10 Protein, Human (CHO) is a CHO cell derived anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.
Product Specifications
Product Name Alternative
IL-10 Protein, Human (CHO), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-10-protein-human-cho.html
Purity
98.0
Smiles
SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Molecular Formula
3586 (Gene_ID) P22301 (S19-N178) (Accession)
Molecular Weight
Approximately 10-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Fedorak RN, et al. Recombinant human interleukin 10 in the treatment of patients with mild to moderately active Crohn's disease. The Interleukin 10 Inflammatory Bowel Disease Cooperative Study Group. Gastroenterology. 2000 Dec;119 (6) :1473-82.|[2]Chakraborty A, et al. Pharmacodynamic interaction of recombinant human interleukin-10 and prednisolone using in vitro whole blood lymphocyte proliferation. J Pharm Sci. 2002 May;91 (5) :1334-42.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MBS8424562-01 0.12 mL
Rabbit Anti Human PRPF3 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)
Ask
View Details 
MBS8424562-02 0.2 mL
Rabbit Anti Human PRPF3 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)
Ask
View Details MBS8424562-03 5x 0.2 mL
Rabbit Anti Human PRPF3 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)
Ask
View Details 