Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Human (CHO)

IL-10 Protein, Human (CHO) is a CHO cell derived anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

Product Specifications

Product Name Alternative

IL-10 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-human-cho.html

Purity

98.0

Smiles

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Formula

3586 (Gene_ID) P22301 (S19-N178) (Accession)

Molecular Weight

Approximately 10-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Fedorak RN, et al. Recombinant human interleukin 10 in the treatment of patients with mild to moderately active Crohn's disease. The Interleukin 10 Inflammatory Bowel Disease Cooperative Study Group. Gastroenterology. 2000 Dec;119 (6) :1473-82.|[2]Chakraborty A, et al. Pharmacodynamic interaction of recombinant human interleukin-10 and prednisolone using in vitro whole blood lymphocyte proliferation. J Pharm Sci. 2002 May;91 (5) :1334-42.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nkx6-3 Mouse Gene Knockout Kit (CRISPR)
KN511030 1 Kit

Nkx6-3 Mouse Gene Knockout Kit (CRISPR)

Ask
View Details
TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: LBI13H3]
AMM15883VCF 100 µg

TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: LBI13H3]

Ask
View Details
Rabbit myelin protein 2 (p2) ELISA Kit
EIA07799Rb 1 Kit

Rabbit myelin protein 2 (p2) ELISA Kit

Ask
View Details
SMNDC1 (Survival of Motor Neuron-Related-Splicing Factor 30, Survival Motor Neuron Domain Containing 1)
492335 100 µL

SMNDC1 (Survival of Motor Neuron-Related-Splicing Factor 30, Survival Motor Neuron Domain Containing 1)

Ask
View Details
Bethanechol chloride 5g
A10180-5000 5000 mg

Bethanechol chloride 5g

Ask
View Details
PIH1D1, ID (PIH1D1, NOP17, PIH1 domain-containing protein 1, Nucleolar protein 17 homolog) (MaxLight 750) discontinued
040037-ML750 100 µL

PIH1D1, ID (PIH1D1, NOP17, PIH1 domain-containing protein 1, Nucleolar protein 17 homolog) (MaxLight 750) discontinued

Ask
View Details